DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and SEH1

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_011415.1 Gene:SEH1 SGDID:S000003068 Length:349 Species:Saccharomyces cerevisiae

Alignment Length:365 Identity:113/366 (31%)
Similarity:189/366 (52%) Gaps:69/366 (19%)


  Fly     4 VEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIW--DEDGQGKWNVTSSWKAHSGSIWRVSWA 66
            ::|..:.|.|::||||:|:|||.:|||||||.:|::  |:| ...|.::.||:||..||..:.||
Yeast     1 MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKD-TSNWELSDSWRAHDSSIVAIDWA 64

  Fly    67 HPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLL 131
            .||:|:::|:.|:|:|..:|||...::..|    .|||.:..||.||:.|:..|:|||.:|||.|
Yeast    65 SPEYGRIIASASYDKTVKLWEEDPDQEECS----GRRWNKLCTLNDSKGSLYSVKFAPAHLGLKL 125

  Fly   132 ATASADGIIRIYEAPDIMNLSQWPVQHEI-------SNKLPLS-CLSWNTSTYMVTQLLAAGSDE 188
            |....|||:|:|:|.:..:|..|.:..|:       :|.|... ||||..|.:...:|..:..::
Yeast   126 ACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSPEKLAVSALEQ 190

  Fly   189 AAT----PTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKDLYI--- 246
            |..    ..||:.:.|.....:..::            .:::||:.||.:.::|...||..|   
Yeast   191 AIIYQRGKDGKLHVAAKLPGHKSLIR------------SISWAPSIGRWYQLIATGCKDGRIRIF 243

  Fly   247 ----------------------------VNLRGVTDATDISKLDIQT-------IKFSEHNCPVW 276
                                        ::.:|.:|:....|.::|:       .:..:||..||
Yeast   244 KITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEHDDHNGEVW 308

  Fly   277 RVCWNMLATMLISTGDDGCVRLWRMNYNRQWRCAAVLKAE 316
            .|.||:..|:|.|.||||.||||:..|:.:::|.:|:.|:
Yeast   309 SVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQ 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 110/355 (31%)
WD40 11..300 CDD:295369 108/341 (32%)
WD40 repeat 16..55 CDD:293791 21/41 (51%)
WD40 repeat 60..98 CDD:293791 14/38 (37%)
WD40 repeat 118..159 CDD:293791 17/41 (41%)
WD40 repeat 166..212 CDD:293791 10/51 (20%)
WD40 repeat 221..267 CDD:293791 12/84 (14%)
WD40 repeat 275..299 CDD:293791 15/24 (63%)
SEH1NP_011415.1 WD40 7..332 CDD:330360 108/342 (32%)
WD40 repeat 13..53 CDD:293791 21/41 (51%)
WD40 repeat 58..105 CDD:293791 19/51 (37%)
WD40 repeat 112..158 CDD:293791 18/46 (39%)
WD40 repeat 165..207 CDD:293791 11/42 (26%)
WD40 repeat 215..262 CDD:293791 8/59 (14%)
WD40 repeat 307..346 CDD:293791 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31170199
eggNOG 1 0.900 E1_KOG2445
Hieranoid 1 1.000
Homologene 1 1.000 H68701
Inparanoid 1 1.050 192 1.000 Inparanoid score I889
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003642
OrthoInspector 1 1.000 T1135899
orthoMCL 1 0.900 OOG5_130934
Panther 1 1.100 LDO PTHR11024
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1316
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.