DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and SEH1H

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_564830.1 Gene:SEH1H AraportID:AT1G64350 Length:326 Species:Arabidopsis thaliana

Alignment Length:343 Identity:94/344 (27%)
Similarity:149/344 (43%) Gaps:61/344 (18%)


  Fly    25 RRMATCSSDQTVKIWDEDG--------QGKWNV-------------TSSWKAHSGSIWRVSWAHP 68
            :.|||..|..|...|::.|        .||.::             ||..:....||.::.|...
plant     3 KSMATLDSGTTCSSWNQSGDRLAAGSLNGKLSIYESSTSSSSTFSCTSKVRVSESSIVKIVWLPS 67

  Fly    69 EFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLAT 133
            |:|..||....|.:.|:|||:      |.:.....|....::.:..:.|.||:|......|.:..
plant    68 EYGDAVACVCEDGSLSIWEEL------SEDAHGLEWKLCKSMKNKSSQVLDVQFGVSRKSLKMVA 126

  Fly   134 ASADGIIRIYEAPDIMNLSQWPVQHEISNKL-PLSCL----------SWNT---STYMVTQLLAA 184
            |.:||.:|::|..:.:.|..|.:|.|..|.: .||.|          |||.   .....:.:||.
plant   127 AYSDGYLRVFELLNPLELKNWQLQAEFQNVIDSLSTLGKPSSLSASVSWNPMKGEEQEPSFVLAF 191

  Fly   185 GSDEAATPTGKVFLFAYSENSRKCV-KIDTVNDITDPVTDVAFAPNAGRTFHMLAVASK---DLY 245
            .||.....:.|::.|..:.|....| ::....|..|||..:::|||.||.:.::|||:.   .::
plant   192 NSDSPHLNSSKIWEFDEAHNRWLAVAELALPEDKGDPVYALSWAPNIGRPYEVVAVATHKGIGIW 256

  Fly   246 IVNLRGVTDATDI-SKLDIQTI-KFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQWR 308
            .|.|     |.|: .:|.::.: ..|.|...||::.|:|....|.|||.||.|:||:.|.|.:|.
plant   257 HVGL-----APDLEGRLPVKKVSSLSGHQGEVWQMEWDMSGMTLASTGSDGMVKLWQSNLNGEWH 316

  Fly   309 CAAVLKAEGSGPTYEPAP 326
            ..|         |.||.|
plant   317 EQA---------TLEPVP 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 89/325 (27%)
WD40 11..300 CDD:295369 86/316 (27%)
WD40 repeat 16..55 CDD:293791 11/51 (22%)
WD40 repeat 60..98 CDD:293791 12/38 (32%)
WD40 repeat 118..159 CDD:293791 12/41 (29%)
WD40 repeat 166..212 CDD:293791 14/60 (23%)
WD40 repeat 221..267 CDD:293791 14/51 (27%)
WD40 repeat 275..299 CDD:293791 12/24 (50%)
SEH1HNP_564830.1 WD40 9..>317 CDD:225201 86/319 (27%)
WD40 10..308 CDD:295369 83/309 (27%)
WD40 repeat 13..54 CDD:293791 7/41 (17%)
WD40 repeat 60..105 CDD:293791 12/51 (24%)
WD40 repeat 110..163 CDD:293791 17/53 (32%)
WD40 repeat 171..222 CDD:293791 11/51 (22%)
WD40 repeat 229..277 CDD:293791 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D944756at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11024
Phylome 1 0.910 0.667 Consistency score
33.020

Return to query results.
Submit another query.