DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup44A and SEH1H

DIOPT Version :9

Sequence 1:NP_610343.1 Gene:Nup44A / 35762 FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_564830.1 Gene:SEH1H / 842741 AraportID:AT1G64350 Length:326 Species:Arabidopsis thaliana


Alignment Length:343 Identity:94/343 - (27%)
Similarity:149/343 - (43%) Gaps:61/343 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RRMATCSSDQTVKIWDEDG--------QGKWNV-------------TSSWKAHSGSIWRVSWAHP 68
            :.|||..|..|...|::.|        .||.::             ||..:....||.::.|...
plant     3 KSMATLDSGTTCSSWNQSGDRLAAGSLNGKLSIYESSTSSSSTFSCTSKVRVSESSIVKIVWLPS 67

  Fly    69 EFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLAT 133
            |:|..||....|.:.|:|||:      |.:.....|....::.:..:.|.||:|......|.:..
plant    68 EYGDAVACVCEDGSLSIWEEL------SEDAHGLEWKLCKSMKNKSSQVLDVQFGVSRKSLKMVA 126

  Fly   134 ASADGIIRIYEAPDIMNLSQWPVQHEISNKL-PLSCL----------SWNT---STYMVTQLLAA 184
            |.:||.:|::|..:.:.|..|.:|.|..|.: .||.|          |||.   .....:.:||.
plant   127 AYSDGYLRVFELLNPLELKNWQLQAEFQNVIDSLSTLGKPSSLSASVSWNPMKGEEQEPSFVLAF 191

  Fly   185 GSDEAATPTGKVFLFAYSENSRKCV-KIDTVNDITDPVTDVAFAPNAGRTFHMLAVASK---DLY 245
            .||.....:.|::.|..:.|....| ::....|..|||..:::|||.||.:.::|||:.   .::
plant   192 NSDSPHLNSSKIWEFDEAHNRWLAVAELALPEDKGDPVYALSWAPNIGRPYEVVAVATHKGIGIW 256

  Fly   246 IVNLRGVTDATDI-SKLDIQTI-KFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQWR 308
            .|.|     |.|: .:|.::.: ..|.|...||::.|:|....|.|||.||.|:||:.|.|.:|.
plant   257 HVGL-----APDLEGRLPVKKVSSLSGHQGEVWQMEWDMSGMTLASTGSDGMVKLWQSNLNGEWH 316

  Fly   309 CAAVLKAEGSGPTYEPAP 326
            ..|         |.||.|
plant   317 EQA---------TLEPVP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 11..300 CDD:392136 85/315 (27%)
WD40 repeat 16..55 CDD:293791 11/50 (22%)
WD40 repeat 60..98 CDD:293791 12/37 (32%)
WD40 repeat 118..159 CDD:293791 12/40 (30%)
WD40 repeat 166..212 CDD:293791 14/59 (24%)
WD40 repeat 221..267 CDD:293791 14/50 (28%)
WD40 repeat 275..299 CDD:293791 11/23 (48%)
SEH1HNP_564830.1 WD40 9..>317 CDD:225201 86/318 (27%)
WD40 10..308 CDD:295369 82/308 (27%)
WD40 repeat 13..54 CDD:293791 7/40 (18%)
WD40 repeat 60..105 CDD:293791 12/50 (24%)
WD40 repeat 110..163 CDD:293791 17/52 (33%)
WD40 repeat 171..222 CDD:293791 11/50 (22%)
WD40 repeat 229..277 CDD:293791 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I3247
eggNOG 1 0.900 - - E1_KOG2445
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944756at2759
OrthoFinder 1 1.000 - - FOG0004075
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103638
Panther 1 1.100 - - LDO PTHR11024
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.