DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and AT3G01340

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001030616.1 Gene:AT3G01340 AraportID:AT3G01340 Length:302 Species:Arabidopsis thaliana

Alignment Length:330 Identity:99/331 (30%)
Similarity:157/331 (47%) Gaps:52/331 (16%)


  Fly     5 EPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWAHPE 69
            :.|...|.|.|||||.||||:|:||.|||.|:||......|.....::...|.|.:|:|:||||:
plant     4 QKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLATLTGHRGPVWQVAWAHPK 68

  Fly    70 FGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLATA 134
            ||.::|:||:|....:|:|  |.:        .:|.:.....|.:.||..:.:||..|||.||..
plant    69 FGSLLASCSYDGQIILWKE--GNQ--------NQWTQAHVFTDHKVSVNSIAWAPHELGLSLACG 123

  Fly   135 SADGIIRIYEAP-----DIMNLSQWPVQHEISNKLPLSCLSWNTSTY-----------MVTQLLA 183
            ::||.|.::.|.     |...:.|       ::.:.::.:||..:|.           .|.:|.:
plant   124 ASDGNISVFSARADGGWDTTKIDQ-------AHPVGVTSVSWAPATEPGALVSSGMIDPVYKLAS 181

  Fly   184 AGSDEAATPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKD----L 244
            .|.|.    |.||:.|  |..|.|......:|..||.|.|||:|||.|.....:|..|:|    :
plant   182 GGCDS----TVKVWKF--SNGSWKMDCFPALNKHTDWVRDVAWAPNLGLPKSTIASGSEDGKVII 240

  Fly   245 YIVNLRGVTDATDISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQWRC 309
            :.:...|......:.| |.:|        |||||.|::...:|..:..:..|.:|:.:.:.:|..
plant   241 WTIGKEGEQWEGTVLK-DFKT--------PVWRVSWSLTGNLLAVSDGNNNVTVWKESVDGEWEQ 296

  Fly   310 AAVLK 314
            ..|::
plant   297 VTVVE 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 98/323 (30%)
WD40 11..300 CDD:295369 96/309 (31%)
WD40 repeat 16..55 CDD:293791 18/39 (46%)
WD40 repeat 60..98 CDD:293791 15/38 (39%)
WD40 repeat 118..159 CDD:293791 13/46 (28%)
WD40 repeat 166..212 CDD:293791 14/57 (25%)
WD40 repeat 221..267 CDD:293791 15/50 (30%)
WD40 repeat 275..299 CDD:293791 7/24 (29%)
AT3G01340NP_001030616.1 WD40 8..>289 CDD:225201 96/313 (31%)
WD40 8..287 CDD:295369 96/311 (31%)
WD40 repeat 15..54 CDD:293791 18/39 (46%)
WD40 repeat 59..101 CDD:293791 16/52 (31%)
WD40 repeat 107..148 CDD:293791 13/48 (27%)
WD40 repeat 153..207 CDD:293791 14/60 (23%)
WD40 repeat 214..251 CDD:293791 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D944756at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.