DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and SEH1L

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_011524044.1 Gene:SEH1L HGNCID:30379 Length:441 Species:Homo sapiens

Alignment Length:366 Identity:194/367 (53%)
Similarity:254/367 (69%) Gaps:36/367 (10%)


  Fly     1 MFDVEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSW 65
            ||....|.|||||:||||.||::|||||||||||:||:||:...|.|:.|:|||.||||:|||:|
Human     1 MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTW 65

  Fly    66 AHPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTR---RWVRRTTLVDSRTSVTDVEFAPKYL 127
            ||||||||:|:|||||||:||||::||    :|...|   .||:||||||||||||||:||||::
Human    66 AHPEFGQVLASCSFDRTAAVWEEIVGE----SNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHM 126

  Fly   128 GLLLATASADGIIRIYEAPDIMNLSQWPVQHEISNKLPLSCLSWN-------------------- 172
            ||:|||.|||||:|||||||:||||||.:|||||.||..||:|||                    
Human   127 GLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSRISKLIEKMNRAHLYNFH 191

  Fly   173 -TSTYMVTQLLAAGSDEAA-TPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFH 235
             .|:...:.::|.|||::: ....||.:|.|:||:||..|.:|:..:||||.|:|||||.||:||
Human   192 IPSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFH 256

  Fly   236 MLAVASKDLYIVNLRGV----TDATDISKLDIQTI-KFSEHNCPVWRVCWNMLATMLISTGDDGC 295
            :||:|:||:.|..|:.|    |.:...:|.:|..: :|..||..||||.||:..|:|.|:|||||
Human   257 ILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGC 321

  Fly   296 VRLWRMNYNRQWRCAAVLKAEGS--GPTYEPAPPTPTLATT 334
            ||||:.||...|:|..:||..||  ..:.:.....|:|.:|
Human   322 VRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGST 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 184/333 (55%)
WD40 11..300 CDD:295369 178/319 (56%)
WD40 repeat 16..55 CDD:293791 26/39 (67%)
WD40 repeat 60..98 CDD:293791 26/38 (68%)
WD40 repeat 118..159 CDD:293791 32/41 (78%)
WD40 repeat 166..212 CDD:293791 19/68 (28%)
WD40 repeat 221..267 CDD:293791 22/51 (43%)
WD40 repeat 275..299 CDD:293791 17/24 (71%)
SEH1LXP_011524044.1 WD40 11..328 CDD:225201 178/321 (55%)
WD40 11..326 CDD:295369 178/319 (56%)
WD40 repeat 15..55 CDD:293791 27/40 (68%)
WD40 repeat 61..111 CDD:293791 35/54 (65%)
WD40 repeat 116..149 CDD:293791 26/33 (79%)
WD40 repeat 166..232 CDD:293791 19/66 (29%)
WD40 repeat 242..287 CDD:293791 21/45 (47%)
WD40 repeat 301..340 CDD:293791 23/39 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31166521
eggNOG 1 0.900 E1_KOG2445
Hieranoid 1 1.000
Homologene 1 1.000 H68701
Inparanoid 1 1.050 400 1.000 Inparanoid score I1910
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D375879at33208
OrthoFinder 1 1.000 FOG0003642
OrthoInspector 1 1.000 T1073045
orthoMCL 1 0.900 OOG5_130934
Panther 1 1.100 LDO PTHR11024
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1316
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.