DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and AT2G30050

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_180566.1 Gene:AT2G30050 AraportID:AT2G30050 Length:302 Species:Arabidopsis thaliana

Alignment Length:323 Identity:93/324 (29%)
Similarity:150/324 (46%) Gaps:52/324 (16%)


  Fly     5 EPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWAHPE 69
            :.|...|:|::|||..||||:|:||.|||.|:||......|.....::...|.|.:|.|:||||:
plant     4 QKIETGHEDIVHDVQMDYYGKRIATASSDCTIKITGVSNNGGSQQLATLTGHRGPVWEVAWAHPK 68

  Fly    70 FGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLATA 134
            :|.::|:||:|....:|:|  |.:        .:|.:.....|.::||..:.:||..:||.||..
plant    69 YGSILASCSYDGQVILWKE--GNQ--------NQWTQDHVFTDHKSSVNSIAWAPHDIGLSLACG 123

  Fly   135 SADGIIRIYEAP-----DIMNLSQWPVQHEISNKLPLSCLSWNTSTY-----------MVTQLLA 183
            |:||.|.::.|.     |...:.|       ::.:.::.:||..:|.           .|.:|.:
plant   124 SSDGNISVFTARADGGWDTSRIDQ-------AHPVGVTSVSWAPATAPGALVSSGLLDPVYKLAS 181

  Fly   184 AGSDEAATPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKD----L 244
            .|.|.    |.||:..|.......|  ...:...||.|.|||:|||.|.....:|..|:|    :
plant   182 GGCDN----TVKVWKLANGSWKMDC--FPALQKHTDWVRDVAWAPNLGLPKSTIASGSQDGKVII 240

  Fly   245 YIVNLRGVTDATDISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQW 307
            :.|...|......:.| |..|        |||||.|::...:|..:..:..|.:|:...:.:|
plant   241 WTVGKEGEQWEGKVLK-DFMT--------PVWRVSWSLTGNLLAVSDGNNNVTVWKEAVDGEW 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 93/323 (29%)
WD40 11..300 CDD:295369 91/309 (29%)
WD40 repeat 16..55 CDD:293791 17/39 (44%)
WD40 repeat 60..98 CDD:293791 14/38 (37%)
WD40 repeat 118..159 CDD:293791 13/46 (28%)
WD40 repeat 166..212 CDD:293791 12/57 (21%)
WD40 repeat 221..267 CDD:293791 16/50 (32%)
WD40 repeat 275..299 CDD:293791 7/24 (29%)
AT2G30050NP_180566.1 WD40 2..>287 CDD:225201 92/315 (29%)
WD40 8..287 CDD:295369 91/311 (29%)
WD40 repeat 60..101 CDD:293791 15/51 (29%)
WD40 repeat 106..146 CDD:293791 13/40 (33%)
WD40 repeat 154..201 CDD:293791 11/51 (22%)
WD40 repeat 213..254 CDD:293791 13/41 (32%)
WD40 repeat 262..288 CDD:293791 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D944756at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.