DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and sec13

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_998500.1 Gene:sec13 ZFINID:ZDB-GENE-040426-2649 Length:320 Species:Danio rerio

Alignment Length:340 Identity:99/341 (29%)
Similarity:161/341 (47%) Gaps:61/341 (18%)


  Fly     4 VEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWAHP 68
            :..:...|:|:|||...||||.|:||||||::|||:|....|: .:.:..:.|.|.:|:|:||||
Zfish     5 INTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQ-ILVADLRGHEGPVWQVAWAHP 68

  Fly    69 EFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLAT 133
            .:|.::|:||:||...:|:|     .:||      |.:........:||..|.:.|...||:||.
Zfish    69 MYGNILASCSYDRKVIIWKE-----ENST------WDKMYEYTGHDSSVNSVCWGPYDFGLILAC 122

  Fly   134 ASADGIIRIYEAPDIMNLS---QWPVQHEISNKLPLSC--LSWNTSTY---MVTQLLAAGSDEAA 190
            .|:||.|      .::..|   .|.:: :|:|...:.|  :||..:..   ::.|          
Zfish   123 GSSDGAI------SVLTCSGDGHWDIK-KINNAHTIGCNAVSWAPAVVPGSLIEQ---------- 170

  Fly   191 TPTG------KVFLFAYSENSRKCVKID--------TVNDITDPVTDVAFAPNAGRTFHMLAVAS 241
             |||      |.|:....:|..|..|.:        .:...:|.|.||.:||:.|.....:|..|
Zfish   171 -PTGQKPNYIKRFVSGGCDNLVKLWKEEDGQWKEDQKLEAHSDWVRDVGWAPSIGLPTSTIASCS 234

  Fly   242 KD--LYIVNLRGVTDATDISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYN 304
            :|  ::|.........|..:||      ..:.|..||.|.|::...:|..:|.|..|.||:.:.:
Zfish   235 QDGRVFIWTCDDPAGNTWTAKL------LHKFNDVVWHVSWSITGNILAVSGGDNKVTLWKESVD 293

  Fly   305 RQWRCAA-VLKAEGS 318
            .||.|.: |.|.:|:
Zfish   294 GQWACISDVNKGQGA 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 95/327 (29%)
WD40 11..300 CDD:295369 93/313 (30%)
WD40 repeat 16..55 CDD:293791 18/39 (46%)
WD40 repeat 60..98 CDD:293791 16/38 (42%)
WD40 repeat 118..159 CDD:293791 12/44 (27%)
WD40 repeat 166..212 CDD:293791 12/57 (21%)
WD40 repeat 221..267 CDD:293791 13/48 (27%)
WD40 repeat 275..299 CDD:293791 9/24 (38%)
sec13NP_998500.1 WD40 6..>300 CDD:225201 96/330 (29%)
WD40 7..289 CDD:295369 93/318 (29%)
WD40 repeat 61..101 CDD:293791 17/51 (33%)
WD40 repeat 106..152 CDD:293791 15/53 (28%)
WD40 repeat 160..208 CDD:293791 9/59 (15%)
WD40 repeat 214..256 CDD:293791 12/42 (29%)
WD40 repeat 264..290 CDD:293791 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375879at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.