DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and Seh1l

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001347863.1 Gene:Seh1l MGIID:1919374 Length:417 Species:Mus musculus

Alignment Length:328 Identity:189/329 (57%)
Similarity:246/329 (75%) Gaps:14/329 (4%)


  Fly     1 MFDVEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSW 65
            ||....|.|||||:||||.||::|||||||||||:||:||:...|.|:.|:|||.||||:|||:|
Mouse     1 MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTW 65

  Fly    66 AHPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTR---RWVRRTTLVDSRTSVTDVEFAPKYL 127
            ||||||||:|:|||||||:||||::||    :|...|   .||:||||||||||||||:||||::
Mouse    66 AHPEFGQVLASCSFDRTAAVWEEIVGE----SNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHM 126

  Fly   128 GLLLATASADGIIRIYEAPDIMNLSQWPVQHEISNKLPLSCLSWNTSTYMV-TQLLAAGSDEAA- 190
            ||:|||.|||||:|:|||||:||||||.:|||:|.||..||:|||.|:... ..::|.|||::: 
Mouse   127 GLMLATCSADGIVRVYEAPDVMNLSQWSLQHEVSCKLCCSCISWNPSSSRAHPPMIAVGSDDSSP 191

  Fly   191 TPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKDLYIVNL----RG 251
            ....||.:|.|:||:||..|.:|:..:||||.|:|||||.||:||:||||:||:.|..|    :.
Mouse   192 NSMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAVATKDVRIFTLKPLRKE 256

  Fly   252 VTDATDISKLDIQTI-KFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQWRCAAVLKA 315
            :|.:...:|.:|..: :|..||..||||.||:..|:|.|:|||||||||:.||...|:|..:||.
Mouse   257 LTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKG 321

  Fly   316 EGS 318
            .||
Mouse   322 NGS 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 182/313 (58%)
WD40 11..300 CDD:295369 176/299 (59%)
WD40 repeat 16..55 CDD:293791 26/39 (67%)
WD40 repeat 60..98 CDD:293791 26/38 (68%)
WD40 repeat 118..159 CDD:293791 31/41 (76%)
WD40 repeat 166..212 CDD:293791 19/48 (40%)
WD40 repeat 221..267 CDD:293791 22/51 (43%)
WD40 repeat 275..299 CDD:293791 17/24 (71%)
Seh1lNP_001347863.1 WD 1 10..49 27/39 (69%)
WD40 11..306 CDD:330360 176/299 (59%)
WD40 repeat 15..55 CDD:293791 27/40 (68%)
WD 2 55..96 31/45 (69%)
WD40 repeat 61..111 CDD:293791 35/54 (65%)
WD 3 111..152 33/41 (80%)
WD40 repeat 116..149 CDD:293791 25/33 (76%)
WD 4 160..210 21/50 (42%)
WD40 repeat 166..212 CDD:293791 19/46 (41%)
WD 5 217..258 22/41 (54%)
WD40 repeat 222..267 CDD:293791 21/45 (47%)
WD 6 276..315 23/39 (59%)
WD40 repeat 281..320 CDD:293791 23/39 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31166299
eggNOG 1 0.900 E1_KOG2445
Hieranoid 1 1.000
Homologene 1 1.000 H68701
Inparanoid 1 1.050 398 1.000 Inparanoid score I1933
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D375879at33208
OrthoFinder 1 1.000 FOG0003642
OrthoInspector 1 1.000 T1083116
orthoMCL 1 0.900 OOG5_130934
Panther 1 1.100 LDO PTHR11024
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1316
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.