DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and SEC13

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001129498.1 Gene:SEC13 HGNCID:10697 Length:368 Species:Homo sapiens

Alignment Length:339 Identity:105/340 (31%)
Similarity:160/340 (47%) Gaps:58/340 (17%)


  Fly     4 VEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWAHP 68
            :..:...|:|:|||...||||.|:||||||::|||:|....|: .:.:..:.|.|.:|:|:||||
Human    51 INTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQ-ILIADLRGHEGPVWQVAWAHP 114

  Fly    69 EFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLAT 133
            .:|.::|:||:||...:|.|..|           .|.:........:||..|.:||...||:||.
Human   115 MYGNILASCSYDRKVIIWREENG-----------TWEKSHEHAGHDSSVNSVCWAPHDYGLILAC 168

  Fly   134 ASADGIIRI--YEAPDIMNLSQWPVQHEISNKLPLSC--LSWNTSTYMVTQLLAAGS--DEAATP 192
            .|:||.|.:  |...     .||.|: :|:|...:.|  :||       ...:..||  |.   |
Human   169 GSSDGAISLLTYTGE-----GQWEVK-KINNAHTIGCNAVSW-------APAVVPGSLIDH---P 217

  Fly   193 TG------KVFLFAYSENSRKCVKID---------TVNDITDPVTDVAFAPNAGRTFHMLAVASK 242
            :|      |.|.....:|..|..|.:         .:...:|.|.|||:||:.|.....:|..|:
Human   218 SGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQ 282

  Fly   243 D--LYIVNLRGVTDATDISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNR 305
            |  ::|......:..|...||      ..:.|..||.|.|::.|.:|..:|.|..|.||:.:.:.
Human   283 DGRVFIWTCDDASSNTWSPKL------LHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDG 341

  Fly   306 QWRCAA-VLKAEGS 318
            ||.|.: |.|.:||
Human   342 QWVCISDVNKGQGS 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 100/326 (31%)
WD40 11..300 CDD:295369 98/312 (31%)
WD40 repeat 16..55 CDD:293791 18/39 (46%)
WD40 repeat 60..98 CDD:293791 15/38 (39%)
WD40 repeat 118..159 CDD:293791 15/43 (35%)
WD40 repeat 166..212 CDD:293791 13/56 (23%)
WD40 repeat 221..267 CDD:293791 14/48 (29%)
WD40 repeat 275..299 CDD:293791 10/24 (42%)
SEC13NP_001129498.1 WD40 56..335 CDD:330360 97/313 (31%)
WD40 repeat 107..147 CDD:293791 16/51 (31%)
WD40 repeat 152..198 CDD:293791 18/52 (35%)
WD40 repeat 206..255 CDD:293791 10/52 (19%)
WD40 repeat 261..302 CDD:293791 12/41 (29%)
WD40 repeat 311..337 CDD:293791 11/26 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375879at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.