DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and seh1l

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_012820038.1 Gene:seh1l XenbaseID:XB-GENE-1015661 Length:416 Species:Xenopus tropicalis

Alignment Length:329 Identity:188/330 (57%)
Similarity:251/330 (76%) Gaps:16/330 (5%)


  Fly     1 MFDVEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSW 65
            ||....|.|||||:||||.||::|||||||||||:||:||:...|.|:.|:|||.||||:|||:|
 Frog     1 MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSENGDWHCTASWKTHSGSVWRVTW 65

  Fly    66 AHPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTR---RWVRRTTLVDSRTSVTDVEFAPKYL 127
            ||||||||:|:|||||||:||||::||    :|...|   .||:||||||||||||||:||||::
 Frog    66 AHPEFGQVLASCSFDRTAAVWEEIVGE----SNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHM 126

  Fly   128 GLLLATASADGIIRIYEAPDIMNLSQWPVQHEISNKLPLSCLSWNTSTYMV-TQLLAAGSDEAAT 191
            ||:|||.||||::|||||||:||||||.:|||||.||..||:|||.|:... :.::|.|||: ::
 Frog   127 GLMLATCSADGVVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDD-SS 190

  Fly   192 PT--GKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKDLYIVNL----R 250
            |.  |||.::.|:||:||..|.:|:..::|||.|:|||||.||:||:||||:||:.|..:    :
 Frog   191 PNIMGKVQIYEYNENTRKYAKAETLMSVSDPVHDIAFAPNLGRSFHILAVATKDVRIFTMKPLRK 255

  Fly   251 GVTDATDISKLDIQTI-KFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQWRCAAVLK 314
            .::.:..::|.:|.|: :|..||..||||.||:..|:|.|:||||.||||:.||...|:|..|||
 Frog   256 ELSSSGGVTKFEIHTVAQFDNHNSQVWRVSWNITGTVLASSGDDGTVRLWKANYMDNWKCIGVLK 320

  Fly   315 AEGS 318
            .:|:
 Frog   321 GDGN 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 181/314 (58%)
WD40 11..300 CDD:295369 175/300 (58%)
WD40 repeat 16..55 CDD:293791 26/39 (67%)
WD40 repeat 60..98 CDD:293791 26/38 (68%)
WD40 repeat 118..159 CDD:293791 31/41 (76%)
WD40 repeat 166..212 CDD:293791 20/49 (41%)
WD40 repeat 221..267 CDD:293791 21/51 (41%)
WD40 repeat 275..299 CDD:293791 16/24 (67%)
seh1lXP_012820038.1 WD40 11..>308 CDD:225201 175/302 (58%)
WD40 11..306 CDD:295369 175/300 (58%)
WD40 repeat 15..55 CDD:293791 27/40 (68%)
WD40 repeat 61..111 CDD:293791 35/54 (65%)
WD40 repeat 116..149 CDD:293791 25/33 (76%)
WD40 repeat 166..212 CDD:293791 20/47 (43%)
WD40 repeat 222..267 CDD:293791 19/45 (42%)
WD40 repeat 281..320 CDD:293791 23/39 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31164376
eggNOG 1 0.900 E1_KOG2445
Hieranoid 1 1.000
Homologene 1 1.000 H68701
Inparanoid 1 1.050 397 1.000 Inparanoid score I1804
OMA 1 1.010
OrthoDB 1 1.010 D375879at33208
OrthoFinder 1 1.000 FOG0003642
OrthoInspector 1 1.000 T1059136
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1316
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.