DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and Sec13

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001287480.1 Gene:Sec13 FlyBaseID:FBgn0024509 Length:356 Species:Drosophila melanogaster

Alignment Length:327 Identity:91/328 (28%)
Similarity:158/328 (48%) Gaps:58/328 (18%)


  Fly     4 VEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWAHP 68
            ::.|..:|:|::|....|:||..:||||||.:|:|:......|  ..:..|.|.|.:|:|:||||
  Fly     5 LQEIDTEHEDMVHHAALDFYGLLLATCSSDGSVRIFHSRKNNK--ALAELKGHQGPVWQVAWAHP 67

  Fly    69 EFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLAT 133
            :||.::|:||:||...||:          :|..|.|.:.....:..:||..|:|||...||:||.
  Fly    68 KFGNILASCSYDRKVIVWK----------STTPRDWTKLYEYSNHDSSVNSVDFAPSEYGLVLAC 122

  Fly   134 ASADGIIR---------IYEAPDIMNLSQWPVQHEISNKLPLSCLSW--------------NTST 175
            ||:||.:.         :::|..|.|          ::.:.::.:||              .:.:
  Fly   123 ASSDGSVSVLTCNTEYGVWDAKKIPN----------AHTIGVNAISWCPAQAPDPAFDQRVTSRS 177

  Fly   176 YMVTQLLAAGSDEAATPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVA 240
            ..|.:|::.|.|...    |:    :.|::.:.|:...:...:|.|.|||:||:.|.....:|.|
  Fly   178 AAVKRLVSGGCDNLV----KI----WREDNDRWVEEHRLEAHSDWVRDVAWAPSIGLPRSQIATA 234

  Fly   241 SKDLYIVNLRGVTDATDISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNR 305
            |:|.:::......|.::.:...:.|  |.:   .||.:.|:....:|..||.|..|.||:.|...
  Fly   235 SQDRHVIVWSSNADLSEWTSTVLHT--FDD---AVWSISWSTTGNILAVTGGDNNVTLWKENTEG 294

  Fly   306 QW 307
            ||
  Fly   295 QW 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 91/326 (28%)
WD40 11..300 CDD:295369 87/312 (28%)
WD40 repeat 16..55 CDD:293791 14/39 (36%)
WD40 repeat 60..98 CDD:293791 15/38 (39%)
WD40 repeat 118..159 CDD:293791 15/50 (30%)
WD40 repeat 166..212 CDD:293791 9/60 (15%)
WD40 repeat 221..267 CDD:293791 13/46 (28%)
WD40 repeat 275..299 CDD:293791 9/24 (38%)
Sec13NP_001287480.1 WD40 10..289 CDD:330360 87/314 (28%)
WD40 repeat 60..101 CDD:293791 18/51 (35%)
WD40 repeat 106..148 CDD:293791 15/42 (36%)
WD40 repeat 155..207 CDD:293791 9/60 (15%)
WD40 repeat 215..256 CDD:293791 12/41 (29%)
WD40 repeat 264..290 CDD:293791 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31645894
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375879at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11024
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.