DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup44A and sec13

DIOPT Version :9

Sequence 1:NP_610343.1 Gene:Nup44A / 35762 FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_988967.1 Gene:sec13 / 394564 XenbaseID:XB-GENE-944452 Length:320 Species:Xenopus tropicalis


Alignment Length:350 Identity:101/350 - (28%)
Similarity:160/350 - (45%) Gaps:75/350 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWAHP 68
            :..:...|:|:|||...||||.|:||||||::|||:|....|: .:.:..:.|.|.:|:|:||||
 Frog     5 INTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVKNGGQ-ILIADLRGHEGPVWQVAWAHP 68

  Fly    69 EFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLAT 133
            .:|.::|:||:||...:|:|..|           .|.:........:||..|.:||..|||:||.
 Frog    69 MYGNILASCSYDRKVIIWKEENG-----------TWEKTYEYTGHDSSVNSVCWAPHDLGLVLAC 122

  Fly   134 ASADGIIRIY----EAPDIMNLSQWPVQHEISNKLPLSC--LSWNTSTY--------------MV 178
            .|:||.|.|.    :.|       |.|: :|||...:.|  :||..|..              .:
 Frog   123 GSSDGAISILTYTGDGP-------WEVK-KISNAHTIGCNAVSWAPSVVPGSLVDQPSSQKPNYI 179

  Fly   179 TQLLAAGSDEAATPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKD 243
            .:.::.|.|...    |:    :.|...:..:...:...:|.|.|||:||:.|.....:|..|:|
 Frog   180 KRFVSGGCDNLV----KI----WREEDGQWKEDQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQD 236

  Fly   244 LYIVNLRGVTDATDISKLDIQTIKFSEHNC-----------PVWRVCWNMLATMLISTGDDGCVR 297
                           .::.|.|...:..||           .||.|.|::.|.:|..:|.|..|.
 Frog   237 ---------------GRVYIWTSDDAATNCWNPKLLHKFNDVVWHVSWSITANILAVSGGDNKVT 286

  Fly   298 LWRMNYNRQWRCAA-VLKAEGSGPT 321
            ||:.:.:.||.|.: |.|.:|:..|
 Frog   287 LWKESVDGQWACISDVNKGQGAVST 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 11..300 CDD:392136 93/319 (29%)
WD40 repeat 16..55 CDD:293791 18/38 (47%)
WD40 repeat 60..98 CDD:293791 15/37 (41%)
WD40 repeat 118..159 CDD:293791 16/44 (36%)
WD40 repeat 166..212 CDD:293791 8/61 (13%)
WD40 repeat 221..267 CDD:293791 12/45 (27%)
WD40 repeat 275..299 CDD:293791 9/23 (39%)
sec13NP_988967.1 WD40 10..288 CDD:392136 92/320 (29%)
WD40 repeat 61..101 CDD:293791 16/50 (32%)
WD40 repeat 106..152 CDD:293791 20/53 (38%)
WD40 repeat 160..208 CDD:293791 5/55 (9%)
WD40 repeat 214..256 CDD:293791 14/56 (25%)
WD40 repeat 264..290 CDD:293791 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375879at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.