DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and seh1l

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_021323675.1 Gene:seh1l ZFINID:ZDB-GENE-030131-6689 Length:410 Species:Danio rerio

Alignment Length:362 Identity:191/363 (53%)
Similarity:260/363 (72%) Gaps:25/363 (7%)


  Fly     1 MFDVEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSW 65
            ||..:.|.|||||:||||.:|::|||||||||||:||:||:...|:|:.|:|||.||||:|||:|
Zfish     1 MFVAKSIAADHKDLIHDVSYDFHGRRMATCSSDQSVKVWDKGDDGEWHCTASWKTHSGSVWRVTW 65

  Fly    66 AHPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTR---RWVRRTTLVDSRTSVTDVEFAPKYL 127
            ||||||||:|:|||||||:||||::||    :|...|   .|::||||||||||||||:||||::
Zfish    66 AHPEFGQVLASCSFDRTAAVWEEIVGE----SNDKQRGQSHWIKRTTLVDSRTSVTDVKFAPKHM 126

  Fly   128 GLLLATASADGIIRIYEAPDIMNLSQWPVQHEISNKLPLSCLSWNTSTYMV-TQLLAAGSDEA-A 190
            ||:|.|.||||::|||||||:||||||.:|||||.||..||:|||.|:... ..::|.|.|:: .
Zfish   127 GLMLTTCSADGVVRIYEAPDVMNLSQWSLQHEISCKLACSCISWNPSSSRAHPPMIAVGGDDSNG 191

  Fly   191 TPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKDLYIVNL----RG 251
            ..:|||.:..|:||:||..|.:|:..:||||.|:|||||.||:||:||:|:||:.|..|    |.
Zfish   192 AYSGKVQIHEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHVLAIATKDVRIFKLLPLRRE 256

  Fly   252 VTDATDISKLDIQTI-KFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQWRCAAVLKA 315
            ..:::..:|.::|.: :|..||..||||.||:.:|:|.|:|||||||||:.||...|:|..:|:.
Zfish   257 SANSSGPTKFEVQVMAQFDSHNSQVWRVSWNITSTLLASSGDDGCVRLWKANYMDNWKCTGILRG 321

  Fly   316 EGSGPTYEPAPPTPTLAT----------TASATAKFY 342
            :|| |....:.|:..|:.          ..:|||..|
Zfish   322 DGS-PVNGSSGPSAALSAVGVPGAAQMIVGAATAGRY 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 178/313 (57%)
WD40 11..300 CDD:295369 172/299 (58%)
WD40 repeat 16..55 CDD:293791 25/39 (64%)
WD40 repeat 60..98 CDD:293791 26/38 (68%)
WD40 repeat 118..159 CDD:293791 30/41 (73%)
WD40 repeat 166..212 CDD:293791 18/48 (38%)
WD40 repeat 221..267 CDD:293791 21/51 (41%)
WD40 repeat 275..299 CDD:293791 17/24 (71%)
seh1lXP_021323675.1 WD40 11..306 CDD:330360 172/299 (58%)
WD40 repeat 15..55 CDD:293791 26/40 (65%)
WD40 repeat 61..111 CDD:293791 34/54 (63%)
WD40 repeat 116..149 CDD:293791 24/33 (73%)
WD40 repeat 166..212 CDD:293791 18/46 (39%)
WD40 repeat 222..275 CDD:293791 22/53 (42%)
WD40 repeat 281..307 CDD:293791 18/26 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31160870
eggNOG 1 0.900 E1_KOG2445
Hieranoid 1 1.000
Homologene 1 1.000 H68701
Inparanoid 1 1.050 396 1.000 Inparanoid score I1880
OMA 1 1.010
OrthoDB 1 1.010 D375879at33208
OrthoFinder 1 1.000 FOG0003642
OrthoInspector 1 1.000 T1052419
orthoMCL 1 0.900 OOG5_130934
Panther 1 1.100 LDO PTHR11024
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1316
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.