DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and Sec13

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001006979.1 Gene:Sec13 RGDID:1359555 Length:322 Species:Rattus norvegicus

Alignment Length:339 Identity:103/340 (30%)
Similarity:161/340 (47%) Gaps:58/340 (17%)


  Fly     4 VEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWAHP 68
            :..:...|:|:|||...||||.|:||||||::|||:|....|: .:.:..:.|.|.:|:|:||||
  Rat     5 INTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQ-ILIADLRGHEGPVWQVAWAHP 68

  Fly    69 EFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLAT 133
            .:|.::|:||:||...:|:|..|           .|.:........:||..|.:||...||:||.
  Rat    69 MYGNILASCSYDRKVIIWKEENG-----------TWEKTHEHSGHDSSVNSVCWAPHDYGLILAC 122

  Fly   134 ASADGIIRI--YEAPDIMNLSQWPVQHEISNKLPLSC--LSWNTSTYMVTQLLAAGS--DEAATP 192
            .|:||.|.:  |...     .||.|: :|:|...:.|  :||       ...:..||  |:   |
  Rat   123 GSSDGAISLLTYTGE-----GQWEVK-KINNAHTIGCNAVSW-------APAVVPGSLIDQ---P 171

  Fly   193 TG------KVFLFAYSENSRKCVKID---------TVNDITDPVTDVAFAPNAGRTFHMLAVASK 242
            :|      |.|.....:|..|..:.:         .:...:|.|.|||:||:.|.....:|..|:
  Rat   172 SGQKPNYIKKFASGGCDNLIKLWREEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQ 236

  Fly   243 D--LYIVNLRGVTDATDISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNR 305
            |  ::|......:......||      ..:.|..||.|.|::.|.:|..:|.|..|.||:.:.:.
  Rat   237 DGRVFIWTCDDASGNMWSPKL------LHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDG 295

  Fly   306 QWRCAA-VLKAEGS 318
            ||.|.: |.|.:||
  Rat   296 QWVCISDVNKGQGS 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 98/326 (30%)
WD40 11..300 CDD:295369 96/312 (31%)
WD40 repeat 16..55 CDD:293791 18/39 (46%)
WD40 repeat 60..98 CDD:293791 15/38 (39%)
WD40 repeat 118..159 CDD:293791 15/43 (35%)
WD40 repeat 166..212 CDD:293791 12/56 (21%)
WD40 repeat 221..267 CDD:293791 13/48 (27%)
WD40 repeat 275..299 CDD:293791 10/24 (42%)
Sec13NP_001006979.1 WD40 10..289 CDD:330360 95/313 (30%)
WD 1 11..50 21/40 (53%)
WD 2 55..96 18/52 (35%)
WD40 repeat 61..101 CDD:293791 16/51 (31%)
WD 3 101..144 17/49 (35%)
WD40 repeat 106..152 CDD:293791 18/52 (35%)
WD 4 148..204 12/66 (18%)
WD40 repeat 160..209 CDD:293791 9/52 (17%)
WD 5 210..253 12/43 (28%)
WD40 repeat 215..257 CDD:293791 12/42 (29%)
WD 6 260..299 14/39 (36%)
WD40 repeat 265..291 CDD:293791 11/26 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D375879at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.