DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nup44A and npp-18

Sequence 1:NP_610343.1 Gene:Nup44A FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_499740.1 Gene:npp-18 WormBaseID:WBGene00003804 Length:363 Species:Caenorhabditis elegans

Alignment Length:338 Identity:127/339 (37%)
Similarity:201/339 (59%) Gaps:20/339 (6%)


  Fly     4 VEPI--IADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWA 66
            |:|.  :..|:|:||.|.||.:|||||||:||.|:.|||....|.|..::.||.|.|::|||.||
 Worm     7 VKPFQTVGAHRDLIHCVSFDPHGRRMATCASDMTMAIWDRKPDGNWRRSAHWKCHGGAVWRVIWA 71

  Fly    67 HPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLL 131
            ||||||:|||||:|||..:|||.|............:|:|||.:.|:|:.|||:.|:|::|||::
 Worm    72 HPEFGQIVATCSYDRTIVIWEEQIVRSEKDLKQKESQWIRRTIISDNRSDVTDICFSPRHLGLMM 136

  Fly   132 ATASADGIIRIYEAPDIMNLSQWPVQHEI-SNKLPLSCLSWNTSTYMVTQLLAAGSDEAATPTGK 195
            |:.:..|.:||||||||::.|:|.:.||: :......|::|:.|. |...|:|.||||......|
 Worm   137 ASCNVLGTVRIYEAPDIVDASRWNLIHELQAFHTRCGCVTWSLSR-MHRPLIAVGSDEKKAENKK 200

  Fly   196 -VFLFAYSENSRKCVKIDT-VNDITDPVTDVAFAPNAGRTFHMLAVASKDLYIVNLR-------- 250
             |.::...:..||..:|:: |.|:..|:||:.|:|.:....|.|||||.|:::.|::        
 Worm   201 RVVIYENIDGLRKWQRINSLVFDLPCPITDLKFSPISMVDSHQLAVASGDVHVYNIKVARSAILE 265

  Fly   251 --GVTDATDISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQWRCAAVL 313
              ||.:...::..::..:.....:...||:.:|::.:::.||..||.:|.|:..:..||    |.
 Worm   266 EDGVENPIQLADYNLIKVALLGDHRKAWRLRYNLMGSVISSTSLDGTLRSWKSLFVNQW----VK 326

  Fly   314 KAEGSGPTYEPAP 326
            .:|.:...|.|:|
 Worm   327 LSEMNVDDYVPSP 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 6..>309 CDD:225201 121/318 (38%)
WD40 11..300 CDD:295369 118/302 (39%)
WD40 repeat 16..55 CDD:293791 21/39 (54%)
WD40 repeat 60..98 CDD:293791 23/38 (61%)
WD40 repeat 118..159 CDD:293791 20/41 (49%)
WD40 repeat 166..212 CDD:293791 15/47 (32%)
WD40 repeat 221..267 CDD:293791 14/56 (25%)
WD40 repeat 275..299 CDD:293791 8/24 (33%)
npp-18NP_499740.1 WD40 <5..250 CDD:295369 107/244 (44%)
WD40 11..>338 CDD:225201 124/332 (37%)
WD40 repeat 21..60 CDD:293791 21/39 (54%)
WD40 repeat 65..115 CDD:293791 27/50 (54%)
WD40 repeat 123..162 CDD:293791 19/39 (49%)
WD40 repeat 174..220 CDD:293791 15/47 (32%)
WD40 repeat 228..265 CDD:293791 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C30742315
eggNOG 1 0.900 E1_KOG2445
Hieranoid 1 1.000
Homologene 1 1.000 H68701
Inparanoid 1 1.050 242 1.000 Inparanoid score I2066
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D375879at33208
OrthoFinder 1 1.000 FOG0003642
OrthoInspector 1 1.000 T475779
orthoMCL 1 0.900 OOG5_130934
Panther 1 1.100 LDO PTHR11024
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1316
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.