DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8726 and SNX29

Sequence 1:NP_610341.2 Gene:CG8726 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_011521040.1 Gene:SNX29 HGNCID:30542 Length:879 Species:Homo sapiens

Alignment Length:360 Identity:68/361 (19%)
Similarity:101/361 (28%) Gaps:199/361 (55%)


  Fly     5 ASRYERKL----------------------------------------PIDDTQALSCEITAVQE 29
            ||.|||||                                        |:....:.:.|..::.:
Human   595 ASSYERKLIEVAEMHGELIEFNERLHRALVAKEALVSQMRQELIDLRGPVPGDLSQTSEDQSLSD 659

  Fly    30 VAGHTEYLLRVW------RG-ASN------------KNYWTVLRRYNDFDRLDKSL-----RVSG 70
            .......|:.||      || |:|            .:.|.:.|||.:|..|...|     :|..
Human   660 FEISNRALINVWIPSVFLRGKAANAFHVYQVYIRIKDDEWNIYRRYTEFRSLHHKLQNKYPQVRA 724

  Fly    71 IELPLPRKRIFGNMRP-------------------------------------EFIAERKQALQE 98
            ...| |:|.| ||..|                                     :|:.||::.||.
Human   725 YNFP-PKKAI-GNKPPPSPAWMTAAASLLASLLPALPPLNLQVTSEVTSSQDAKFVEERRKQLQN 787

  Fly    99 YINAVL-----MNPILASSLPAKR--------FV-----DPESYSQSFHDHAVQNAMLCLRNDTT 145
            |:.:|:     |.|..|:| |.|.        ||     |||:.:|:           ||:    
Human   788 YLRSVMNKVIQMVPEFAAS-PKKETLIQLMPFFVTSWCWDPENQTQT-----------CLQ---- 836

  Fly   146 WSLGGSMGAIGWRLRKHYFKVTTKPPEKSSNKQLVKSGSQTHQSKHFAAGSSNGSGHSIDAGTLD 210
                   |.:|: .:.|::                                       |..|.  
Human   837 -------GTLGY-CQSHFW---------------------------------------ISCGW-- 852

  Fly   211 PGSEVVAEWLEYGPDKFIDEKEIGGIMKSLMGLQH 245
                    |..:.|   |..:|:||  |.|.|.||
Human   853 --------WKSWRP---ISNQEVGG--KGLDGCQH 874

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 43/198 (22%)
PKc 237..432 CDD:270622 5/10 (50%)
SNX29XP_011521040.1 RUN 54..189 CDD:280855
Ax_dynein_light <487..552 CDD:287215
PX_RUN 668..820 CDD:132810 35/155 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.