DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8726 and snx15

Sequence 1:NP_610341.2 Gene:CG8726 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001093667.1 Gene:snx15 XenbaseID:XB-GENE-492800 Length:342 Species:Xenopus tropicalis

Alignment Length:137 Identity:37/138 (27%)
Similarity:56/138 (41%) Gaps:29/138 (21%)


  Fly     6 SRYERKLPIDDTQALSCEITAVQEVAGHTEYLLRVWRGASNKN--------YWTVLRRYNDFDRL 62
            ::|||:..:.||:.         ...|.|||.:.. :..|.||        .|   :||:||.:|
 Frog     9 TQYERRYNVTDTRT---------NPKGFTEYKVTA-QFISKKNPQDVKEVLVW---KRYSDFKKL 60

  Fly    63 DKSLRVSGIEL--------PLPRKRIFGNMRPEFIAERKQALQEYINAVLMNPILASSLPAKRFV 119
            ...|..:...|        |.||.::||......|.||:||.::.:...:..|.|.:|...|.|.
 Frog    61 HGELSYTHRNLFQRCQEFPPFPRAQVFGRFEAPVIEERRQAAEDMLKFTVNIPALYNSPQLKDFF 125

  Fly   120 DPESYSQ 126
            .....||
 Frog   126 REGEVSQ 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 34/131 (26%)
PKc 237..432 CDD:270622
snx15NP_001093667.1 PX_SNX15 11..128 CDD:132821 35/130 (27%)
MIT_SNX15 267..340 CDD:239140
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.