DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8726 and snx13

Sequence 1:NP_610341.2 Gene:CG8726 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_021323912.1 Gene:snx13 ZFINID:ZDB-GENE-050306-12 Length:966 Species:Danio rerio

Alignment Length:175 Identity:45/176 (26%)
Similarity:76/176 (43%) Gaps:40/176 (23%)


  Fly    36 YLLRVWRGAS--NKNYWTVLRRYNDFD----RLDKSLRVSGIELPLPRKRIFGNMRPEFIAERKQ 94
            |.:.|.|..|  :::.|...|||:||.    |:.:........|.||.|:.|.||..||:.:||:
Zfish   594 YTITVIRKNSDGSEDTWKTYRRYSDFHDFHMRITEQFESLAPILKLPGKKTFNNMDREFLEKRKK 658

  Fly    95 ALQEYINAVLMNPILASSLP-----AKRFVDPESYSQSFHDHA----------------VQNAML 138
            .|..|:. :|:||.:..:.|     ...|::.::||:...:.|                |.||:.
Zfish   659 DLNAYLQ-LLLNPEMVKACPILMPYVYDFLENKAYSKGKREFARKMDTFVNPLRSSMRNVSNAVK 722

  Fly   139 CLRND-------TTWSLGGSMGAIGWRLRKHYFKVTTKPP--EKS 174
            .|.:.       .:..:|.....:|..:::..|||   ||  :||
Zfish   723 SLPDSLAEGVSKVSADMGRMSEKLGQDIKQSIFKV---PPLIQKS 764

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 31/107 (29%)
PKc 237..432 CDD:270622
snx13XP_021323912.1 PXA 98..284 CDD:321992
RGS 378..513 CDD:321993
PX_SNX13 559..690 CDD:132783 29/97 (30%)
Nexin_C 806..915 CDD:312222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.