DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8726 and CG7156

Sequence 1:NP_610341.2 Gene:CG8726 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_650697.1 Gene:CG7156 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster

Alignment Length:643 Identity:117/644 (18%)
Similarity:199/644 (31%) Gaps:226/644 (35%)


  Fly     8 YERKLPIDDTQALSCEITAVQEVAGHTEYLLRVWRGASNKNYWTVLRRYNDFDRLDKSLRVSGIE 72
            :.|.:|    |||:|               |.||     |.:..|.|.:.:..|..|||::.| :
  Fly    34 FPRSVP----QALTC---------------LVVW-----KRFHDVKRLHRELSRRHKSLQLPG-K 73

  Fly    73 LPLPR-KRIFGNMRPEFIAERKQALQEYINAVLMNPILASSLPAKRFVD--PESYSQSFHDHAVQ 134
            ||:|. ...|.......|..||:.:.:.::....:|.|.......:|..  |...........|:
  Fly    74 LPVPTDSTYFKRFDAAVIQRRKEYILQLLDFAAQHPALYKCSTFTQFFQETPSPNGSPLKKLYVE 138

  Fly   135 NAMLCLRNDTTWSLGGS-----MGAIGWRLRKHYFKVTTK--------------PPEKSSNKQLV 180
            .::.....|.....|||     .|||.        .:..|              |.:...:|:..
  Fly   139 RSLRLQTEDNGCGSGGSETGTCAGAIA--------DICDKLDLPYDPHDAGGITPLDPRCDKEQT 195

  Fly   181 KSGSQTHQSKHFAAGSSNGSGHSIDAGT-LDPGSEVVAEWLEY----GPDKFIDEKEIGGIMKSL 240
            .:.||..:::             |:..| .:|.::|.....:|    .|...|:..:...|.::.
  Fly   196 NNESQAKETE-------------IELETKQEPKTDVALTKRDYLRLLTPMASIESDDSDYIYEAA 247

  Fly   241 MGLQHPHIEPVLL---AAHTENGCLVIRKFHKHGTLKDVLCMAANPKNTFLSKYGNPKGRTALSM 302
            :...|.....|.|   .||..         :|||.  |:|...|        |..:.:.|..::.
  Fly   248 LEFSHAVQAEVNLEYAEAHER---------YKHGV--DLLLNGA--------KQDSSEERRFIAK 293

  Fly   303 KQVATYGKQILEALIFLHSKGYAYGHLHSGNIVIVDDC-VKLLDIENFLLGVPAFYRPFFMQHSK 366
            .::|.|..:..|              :|:.  .:.:|| .|.|..:                   
  Fly   294 AKIAKYLARAEE--------------IHAN--FLANDCPTKKLQFQ------------------- 323

  Fly   367 IHAIETIDVYCFGHVLFEMAMGYPLQESVVRQITECP-------EALKCLLESILSKEACKAGLP 424
             .:::|.|.....|:                   |||       :.|:.|.:.::..:...    
  Fly   324 -LSLDTTDGGSVSHL-------------------ECPWNQLARYKVLQILQDRVMQVQCVT---- 364

  Fly   425 TLEQLLGHRFFLQYASTESAGAAANAEKPYFKLSLNAKELLKQAAIKSENRLRDEQKSVKNQKRI 489
                          .|.:.|......|||       |...|.|              |:...:::
  Fly   365 --------------KSQQPAAIMKGVEKP-------ASHSLTQ--------------SIFLPQQV 394

  Fly   490 VRVQELMSSEEEKRKSKQKAKLEHKQSKLKQQSSIQTNNGRLSLVAATAAAASSSTTVVGELCGT 554
            ..:.:|::..:    |:||..|..:|::          .|.|.....:....||.:...|||.  
  Fly   395 PYMVQLLAYFQ----SEQKIFLLLRQAE----------GGMLYDYLQSYTPTSSKSVNYGELF-- 443

  Fly   555 DSFNRSDSTPEEPTTLAGIKSPPLTPGPHLGSIY---QQELPSTTGAPVERQSS--TP 607
                .||..|||...    :.||||....:..:.   ||.|.|.|......|:.  ||
  Fly   444 ----PSDQEPEEKEA----EEPPLTSDSDVSDLVRSSQQLLKSVTNTLSNLQAGVVTP 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 27/122 (22%)
PKc 237..432 CDD:270622 29/206 (14%)
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791 27/115 (23%)
MIT_SNX15 241..315 CDD:239140 19/109 (17%)
PKc_like 343..665 CDD:304357 41/215 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.