DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8726 and Snx22

Sequence 1:NP_610341.2 Gene:CG8726 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001020783.1 Gene:Snx22 MGIID:2685966 Length:192 Species:Mus musculus

Alignment Length:232 Identity:54/233 (23%)
Similarity:83/233 (36%) Gaps:72/233 (31%)


  Fly    32 GHTEYLLRV-WRGASNKNYWTVLRRYNDFDRLDKSLRVSGIELP-LPRKRIFGNMRPEFIAERKQ 94
            ||..:.:.| :.|..:    ||.|||::|..|.|.:: ...::| .|.||: .|.|...:.:|:|
Mouse    23 GHMVFQVEVLYSGRRH----TVPRRYSEFHALHKRIK-KRYKVPDFPSKRL-PNWRTRGLEQRRQ 81

  Fly    95 ALQEYINAVLMNPILASSLPAKRFVDPESYSQSFHDHAVQNAMLCLRNDTTWSLGGSMGAIGWRL 159
            .|:.||..:|   .|...:| |..::                .|.||:..|.|...|...:|..|
Mouse    82 GLETYIQGIL---YLNQDVP-KELLE----------------FLRLRHFPTDSKTSSWSTLGEFL 126

  Fly   160 RKHYFKVTTKPPEKSSNKQLVKSGSQTHQSKHFAAGSSNGSGHSIDAGTLDPGSEVVAEWLEYGP 224
                       |..:|        ||.|.....        |..:|.....|..|.:       |
Mouse   127 -----------PSDTS--------SQLHHRPVI--------GFCMDPYVCTPSPEPL-------P 157

  Fly   225 DKFIDEKEIGGIMKSLMGLQHPHIEPVLLAAHTENGC 261
            :..:|     |:::.|.|..   ..||  .|..|..|
Mouse   158 EVVVD-----GVLQGLYGFS---TSPV--PAQPEANC 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 27/102 (26%)
PKc 237..432 CDD:270622 7/26 (27%)
Snx22NP_001020783.1 PX_SNX22 2..115 CDD:132790 32/118 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.