DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8726 and SGK3

Sequence 1:NP_610341.2 Gene:CG8726 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001028750.1 Gene:SGK3 HGNCID:10812 Length:496 Species:Homo sapiens

Alignment Length:482 Identity:109/483 (23%)
Similarity:170/483 (35%) Gaps:141/483 (29%)


  Fly    21 SCEITAVQEVAGHTE-------YLLRVWRGASNKNYWTVLRRYNDFDRLDKSLR--VSGIELPLP 76
            ||...::.....|.|       |.:.|..|.|.   |.|.|||.:||:|..:|:  ...:.|.:|
Human    12 SCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSE---WFVFRRYAEFDKLYNTLKKQFPAMALKIP 73

  Fly    77 RKRIFG-NMRPEFIAERKQALQEYINAVLMNPILASSLPAKRFVDPESYSQSFHDHAVQNAMLCL 140
            .||||| |..|:||.:|:..|.|:|..::..|.|.:....:.|:..:|                 
Human    74 AKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDS----------------- 121

  Fly   141 RNDTTWSLGGSMGAIGWRLRKHYFKVTTKPPEKSSNKQLVKSGSQTHQ-SKHFAAGSSNGSGHS- 203
                               .||....:....|:||.|        .|. |::...|.| |:.|: 
Human   122 -------------------PKHQSDPSEDEDERSSQK--------LHSTSQNINLGPS-GNPHAK 158

  Fly   204 ---------IDAGTLDPGSEVVAEWLEYGPDKF-----------IDEKEIGGIMKS----LMGLQ 244
                     |..|:.  |..::|:....|  ||           ::.||...||..    |..::
Human   159 PTDFDFLKVIGKGSF--GKVLLAKRKLDG--KFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVK 219

  Fly   245 HPHIEPVLLAAHTENGCLVIRKFHKHGTLKDVLCMAANPKNTFLSKYGNPKGRTALSMKQVATYG 309
            ||.:..:..:..|......:..|...|.    |......:.:|      |:.|...       |.
Human   220 HPFLVGLHYSFQTTEKLYFVLDFVNGGE----LFFHLQRERSF------PEHRARF-------YA 267

  Fly   310 KQILEALIFLHSKGYAYGHLHS--------GNIVIVD-----DCVKLLDIENFLLGVPAFYRPFF 361
            .:|..||.:|||....|..|..        |::|:.|     :.:.:.|......|.|.:..|..
Human   268 AEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEV 332

  Fly   362 MQHSKIHAIETIDVYCFGHVLFEMAMGYPLQESVVRQITEC-------PEALK--------CLLE 411
            ::.....  .|:|.:|.|.||:||..|.|  ....|.:.|.       |.:|:        .:||
Human   333 IRKQPYD--NTVDWWCLGAVLYEMLYGLP--PFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILE 393

  Fly   412 SILSKEACKAGLPTLEQLL---GHRFF 435
            .:|.|:. :..|...|..|   .|.||
Human   394 ELLEKDR-QNRLGAKEDFLEIQNHPFF 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 36/121 (30%)
PKc 237..432 CDD:270622 48/230 (21%)
SGK3NP_001028750.1 PX_CISK 12..120 CDD:132780 35/111 (32%)
STKc_SGK3 165..490 CDD:270755 61/282 (22%)
Nuclear localization signal. {ECO:0000250} 195..205 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.