DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8726 and F13E9.1

Sequence 1:NP_610341.2 Gene:CG8726 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_502016.2 Gene:F13E9.1 WormBaseID:WBGene00008750 Length:497 Species:Caenorhabditis elegans

Alignment Length:531 Identity:110/532 (21%)
Similarity:198/532 (37%) Gaps:139/532 (26%)


  Fly    50 WTVLRRYNDFDRLDKSLRVSGIELPLPRKRIFGNMRPEFIAERKQALQEYINAVLMNPIL----- 109
            |||.|||:|||..|....:...:..||.|:..||...|||.||:..|::|:.|:|...:.     
 Worm    46 WTVERRYSDFDAYDVHRFLDRKKSFLPPKKRLGNKDLEFIEERRLELEKYVRALLELEVWYQKQK 110

  Fly   110 -ASSLP--AKRFVDPESYSQSFHDHAVQNAMLCLRNDTTWSLGGSMGAIGW----RLRKHYFKVT 167
             ..|||  ..:|.|       ||.:.:.:.:    :|.:..| |::|. ||    :....||:.|
 Worm   111 NVHSLPLITAKFFD-------FHQYEIHSIV----DDLSLRL-GNLGD-GWLESSQTSPKYFEFT 162

  Fly   168 ----------TKPPEKSS-NKQLVKSGSQTHQSKHFA-----------AGSSNGSGHSIDAGTLD 210
                      .:.||.:: :..:|.....|....|..           .|:||...:|:|. :|.
 Worm   163 PIELHAITERLRLPEPTAPDVNMVADIGNTIDFLHRVRALKIRGQKGYVGTSNIVWNSLDM-SLY 226

  Fly   211 PGSEVVAEWLEYGPDKFIDEKEIGGIMKSLMGLQHPHIEPVLLAAHTENGCLVIRKFHKHGTLKD 275
            ....:.|.|:...     |...|.|| ||:..                    .:|:...|.::|.
 Worm   227 FCKGLKALWIADS-----DVCRINGI-KSIRE--------------------TLRRLVVHYSMKK 265

  Fly   276 VLCMAANPKNTFLSKYGNPKGRTALSMKQVATYGKQILEALIFLHSKGYAYGHLHSGNIVIVDDC 340
            :..:..:.::.          .|.:.::::.|:  :.||.:           .|....|...|:.
 Worm   266 IKDLLFDEEDL----------ETGMLVEEMDTW--KCLEEV-----------DLSFNEIKCFDES 307

  Fly   341 VKLLDIENFLLGVPAFYRPFFMQHSKIHAIETIDVYCFGHVLFEMAMGYPLQESVVRQITECPEA 405
            :|||. |..:|.|         .::.|..|.:  ...|...|.|:    .|..:.:.:|....|.
 Worm   308 MKLLP-EVRVLNV---------SYNSITEIGS--NLAFLSSLTEL----DLSNNTLTKIDGWNEK 356

  Fly   406 LKCLLESILSKEACKAGLPTLEQL--LGHRFFLQYA-----------STESAGAAANAE------ 451
            |..:.:.|||:.|       :|.|  ||..:.|:|.           :.:..|.....|      
 Worm   357 LGNIKKLILSENA-------IEDLSGLGKLYSLEYLDAKGNNIQNLDAVQGIGKLPCLEILLLRD 414

  Fly   452 KPYFKLSLNAKELLKQAAIKSENRLRDEQKSVKNQKRIVRVQELMSSEEEKRKSKQKAKLEHKQS 516
            .|..||.....::|:....:|.....|.::....:...|||:..:...:|:::.::|.:.|..:.
 Worm   415 NPIRKLVEYRTKVLELFGERSSELKLDGRRPEARELDTVRVRMALRKAKEEKEEREKKRRERIEE 479

  Fly   517 KLKQQSSIQTN 527
            :::..|....|
 Worm   480 RIRYISGEDVN 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 31/90 (34%)
PKc 237..432 CDD:270622 35/197 (18%)
F13E9.1NP_502016.2 PX_domain 18..137 CDD:295365 32/102 (31%)
leucine-rich repeat 291..313 CDD:275380 8/34 (24%)
LRR_8 312..392 CDD:290566 22/103 (21%)
LRR_4 312..355 CDD:289563 10/59 (17%)
leucine-rich repeat 314..336 CDD:275380 5/33 (15%)
leucine-rich repeat 337..359 CDD:275380 6/26 (23%)
LRR_4 359..400 CDD:289563 10/48 (21%)
leucine-rich repeat 360..381 CDD:275380 8/28 (29%)
leucine-rich repeat 382..406 CDD:275380 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.