DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8726 and SNX20

Sequence 1:NP_610341.2 Gene:CG8726 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_878274.1 Gene:SNX20 HGNCID:30390 Length:316 Species:Homo sapiens

Alignment Length:115 Identity:34/116 (29%)
Similarity:55/116 (47%) Gaps:25/116 (22%)


  Fly    37 LLRVWRGASNKNYWTVLRRYNDFDRLDKSL------RVSGIELPLPRKRIFGNMRPEFIAERKQA 95
            ::.:..|:.:.|...:.|||:||.:|.|:|      .:..:|  .|||.:.||...|.|.||::|
Human    98 IIVIQTGSFDNNKAVLERRYSDFAKLQKALLKTFREEIEDVE--FPRKHLTGNFAEEMICERRRA 160

  Fly    96 LQEYINAVLMNPILASSLPAKRFVD----PESYSQSFHDHAVQNAMLCLR 141
            ||||:..:.....:..|   :.|:|    ||          ::.|..|||
Human   161 LQEYLGLLYAIRCVRRS---REFLDFLTRPE----------LREAFGCLR 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 30/105 (29%)
PKc 237..432 CDD:270622
SNX20NP_878274.1 PX_SNX20 76..189 CDD:132833 30/106 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.