DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul1 and tnnt2

DIOPT Version :9

Sequence 1:NP_523655.1 Gene:Cul1 / 35742 FlyBaseID:FBgn0015509 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_012809815.1 Gene:tnnt2 / 100493699 XenbaseID:XB-GENE-482614 Length:279 Species:Xenopus tropicalis


Alignment Length:185 Identity:36/185 - (19%)
Similarity:67/185 - (36%) Gaps:35/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 RSLVRDVIECYVELSFNEEDTDAEQQKLSVYKQNFENKFIADTSAF-----YEKESDAFLSTNTV 248
            :.:.:|:.|....:..:.|....|:::|....:..|.:........     .|||..|.::....
 Frog    81 KRMEKDLTELQTLIEVHFESRKKEEEELQALTERMEKRRAERAEQLRIRNEREKERQARVAEERA 145

  Fly   249 TEYLKHVENRLEEETQRVRGF-NSKNGLSYLHETTADVLKSTCEE-----VLIEKHLKI------ 301
            .:..:....|.|::.::.:.| |..:...||.:|...|.|...|.     :|.|:...:      
 Frog   146 RKEEEENRKRAEDDVRKKKAFSNMLHFGGYLQKTERKVGKKQTEREKKKMILTERKTPLNIGNMN 210

  Fly   302 ---FHTEFQNLLNADRNDDLKRMYSLVALSSKNLTDLK------SILENHIL-HQ 346
               ..||.|:|.|        |:|.|.|....:....|      ::|.|.:. ||
 Frog   211 EDKLRTEAQHLFN--------RIYELEAEKYDHQATFKKQKYEINVLRNRVSDHQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul1NP_523655.1 Cullin 21..669 CDD:279260 36/185 (19%)
CULLIN 454..593 CDD:214545
Cullin_Nedd8 701..765 CDD:214883
tnnt2XP_012809815.1 Troponin 81..215 CDD:279349 22/133 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.