DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and DGA1

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_014888.1 Gene:DGA1 SGDID:S000005771 Length:418 Species:Saccharomyces cerevisiae

Alignment Length:394 Identity:116/395 (29%)
Similarity:185/395 (47%) Gaps:85/395 (22%)


  Fly     7 PKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKRTHSI 71
            |...|.|||.||.|:|:...||::.|..:.|.::.     ..|| .:.:.|::|.:.:..     
Yeast    50 PLATPFERRLQTLAVAWHTSSFVLFSIFTLFAIST-----PALW-VLAIPYMIYFFFDRS----- 103

  Fly    72 MDGNGWKINRNNWLFRH------YRDYFPVQLVKTAELPP----NKN------------------ 108
             ...|..:||.:..||.      |.||||:.|:||..|.|    :||                  
Yeast   104 -PATGEVVNRYSLRFRSLPIWKWYCDYFPISLIKTVNLKPTFTLSKNKRVNEKNYKIRLWPTKYS 167

  Fly   109 --------------------YILASFPHGI--LGT-GISINMGLDISKWLQLFPQVRPKVATLDQ 150
                                |:....||||  ||. |.....|.:.||   :||.:...:.||..
Yeast   168 INLKSNSTIDYRNQECTGPTYLFGYHPHGIGALGAFGAFATEGCNYSK---IFPGIPISLMTLVT 229

  Fly   151 NFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGK 215
            .|..|:.|..|.:.|:.|||::..:..|:|              :.::.|:||||:|:|.|....
Yeast   230 QFHIPLYRDYLLALGISSVSRKNALRTLSK--------------NQSICIVVGGARESLLSSTNG 280

  Fly   216 YILTLKNRKGFVKMAIRTGS-SIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPV 279
            ..|.|..||||:|:||:||: ::||.|:|||||..:.::...:|.:.:.|.:.|...|.:..|..
Yeast   281 TQLILNKRKGFIKLAIQTGNINLVPVFAFGEVDCYNVLSTKKDSVLGKMQLWFKENFGFTIPIFY 345

  Fly   280 GRGIFNYSFGFLPNRRRIVQVVGAPIDVVQ--SDQPDAAYVDKIHKQVIDDLEKMFAKYKDQY-I 341
            .||:|||.||.||.|..|..|||.||.|.:  ::.||.. |:..|...|.:|::::.:.:::| :
Yeast   346 ARGLFNYDFGLLPFRAPINVVVGRPIYVEKKITNPPDDV-VNHFHDLYIAELKRLYYENREKYGV 409

  Fly   342 PNSK 345
            |:::
Yeast   410 PDAE 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 100/344 (29%)
DGA1NP_014888.1 LPLAT 80..410 CDD:302626 103/360 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43778321
eggNOG 1 0.900 E1_KOG0831
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I1089
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T634426
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 LDO PTHR12317
Phylome 1 0.910 0.846 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.