DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1941 and DGAT2

DIOPT Version :8

Sequence 1:NP_001286161.1 Gene:CG1941 / 35718 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_115953.2 Gene:DGAT2 / 84649 HGNCID:16940 Length:388 Species:Homo sapiens

Alignment Length:354 Identity:121/355 (34%)
Similarity:195/355 (55%) Gaps:37/355 (10%)


  Fly     3 IEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFY--GSLLWRTIMVIYLVYVYANH 65
            :.|..:. .:|::.|..::...:|||::|...    .:|:|.|  .:..| .|.|:|..::    
Human    56 VTWLNRS-KVEKQLQVISVLQWVLSFLVLGVA----CSAILMYIFCTDCW-LIAVLYFTWL---- 110

  Fly    66 KRTHSIMDGNGWKI--NRNNW-----LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGI 123
                 :.|.|..|.  .|:.|     ::|::|||||:|||||..|...:|||....||||:|.|.
Human   111 -----VFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGA 170

  Fly   124 SINMGLDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKD 188
            ..|...:.::..:.||.:||.:|||..||..|::|..|.|.|:..||::.:.|||:|:.      
Human   171 FCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNG------ 229

  Fly   189 NRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVA 253
                 :.||:.|:||||.|:|.|.|||..:||:|||||||:|:|.|:.:||.:||||.::..||.
Human   230 -----SGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVI 289

  Fly   254 NPPNSRVRRFQDFVKRITGISPLIPVGRGIFNY-SFGFLPNRRRIVQVVGAPIDVVQSDQPDAAY 317
            ....|..|..|...::..|.:|.|..|||:|:. ::|.:|..:.|..|||.||.:.:.:.|....
Human   290 FEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQD 354

  Fly   318 VDKIHKQVIDDLEKMFAKYKDQY-IPNSK 345
            :|..|...::.|.|:|.|:|.:: :|.::
Human   355 IDLYHTMYMEALVKLFDKHKTKFGLPETE 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 110/298 (37%)
DGAT2NP_115953.2 DAGAT 92..388 CDD:112781 112/314 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43734508
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3345
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T130066
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.622 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.