DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and DGAT2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_566952.1 Gene:DGAT2 AraportID:AT3G51520 Length:314 Species:Arabidopsis thaliana

Alignment Length:349 Identity:92/350 (26%)
Similarity:161/350 (46%) Gaps:64/350 (18%)


  Fly     9 GVPMERRRQTFAMAFLILSFMILSFGS-YFFVAAVLFYGSLLW----RTIMVIYL----VYVYAN 64
            |...|.|.:..:..|..:..|.:..|: :|.||.||.  ||::    .::||:.|    :::..:
plant     2 GGSREFRAEEHSNQFHSIIAMAIWLGAIHFNVALVLC--SLIFLPPSLSLMVLGLLSLFIFIPID 64

  Fly    65 HKRTHSIMDGNGWKINRNNWLFRHYRDYFPVQL-VKTAE-LPPNKNYILASFPHGILGTGISINM 127
            |:..:      |.|:.|  ::.:|..:||||.| |:..| ..||:.|:....||.:|..|:   :
plant    65 HRSKY------GRKLAR--YICKHACNYFPVSLYVEDYEAFQPNRAYVFGYEPHSVLPIGV---V 118

  Fly   128 GL-DISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRD 191
            .| |::.::.: |.:  ||......|.||.:|.:....||.:.|::....||.           .
plant   119 ALCDLTGFMPI-PNI--KVLASSAIFYTPFLRHIWTWLGLTAASRKNFTSLLD-----------S 169

  Fly   192 GFTSNAVAILV-GGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANP 255
            |::    .:|| ||.||..........:.|..|:|||::|:..||.:||.|.||:          
plant   170 GYS----CVLVPGGVQETFHMQHDAENVFLSRRRGFVRIAMEQGSPLVPVFCFGQ---------- 220

  Fly   256 PNSRVRRFQ----DFVKRITGISPLIPVGRGIFNYSFGF-LPNRRRIVQVVGAPIDVVQSDQPDA 315
              :||.::.    |...:::......|:   .|...||. ||.|:.:..|||.||:|.::.:|..
plant   221 --ARVYKWWKPDCDLYLKLSRAIRFTPI---CFWGVFGSPLPCRQPMHVVVGKPIEVTKTLKPTD 280

  Fly   316 AYVDKIHKQVIDDLEKMFAKYKDQ 339
            ..:.|.|.|.::.|..:|.::|.:
plant   281 EEIAKFHGQYVEALRDLFERHKSR 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 79/308 (26%)
DGAT2NP_566952.1 PLN02783 1..314 CDD:178380 92/350 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2180
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoInspector 1 1.000 T125450
orthoMCL 1 0.900 OOG5_127120
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.733 Consistency score
65.880

Return to query results.
Submit another query.