DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and MOGAT2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_011543569.1 Gene:MOGAT2 HGNCID:23248 Length:336 Species:Homo sapiens

Alignment Length:302 Identity:117/303 (39%)
Similarity:170/303 (56%) Gaps:24/303 (8%)


  Fly     3 IEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKR 67
            :|:||..:|.|||.||.|:...:.||:.|:........|:||  :..| .:.|:|..:.|.:..:
Human     2 VEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLF--TRFW-LLTVLYAAWWYLDRDK 63

  Fly    68 THS----IMDGNGWKINRNNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMG 128
            ...    |.....|.|    |  ::.:||||:.|||||||.|::|||....|||:|..|...|:.
Human    64 PRQGGRHIQAIRCWTI----W--KYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLC 122

  Fly   129 LDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGF 193
            .:.:.:..:||.:||.:..|...|..|..|..:.|.|||:..||:..::|          ||.| 
Human   123 TESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHIL----------NRKG- 176

  Fly   194 TSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNS 258
            ..|.:.|:|||||||||:.||.:.|.|:||||||::|:..|:.:||.|||||.|:.||:.|...|
Human   177 GGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSGS 241

  Fly   259 RVRRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQV 300
            .:|..|:.:::|.|||..:..|||:|.||||.:|.||.|..|
Human   242 WLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTV 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 101/256 (39%)
MOGAT2XP_011543569.1 LPLAT 41..297 CDD:302626 103/264 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43695959
eggNOG 1 0.900 E1_KOG0831
Hieranoid 1 1.000
Homologene 1 1.000 H57020
Inparanoid 1 1.050 235 1.000 Inparanoid score I3345
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T130066
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 LDO PTHR12317
Phylome 1 0.910 0.677 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.