DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and mogat1

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_012825966.1 Gene:mogat1 XenbaseID:XB-GENE-1004226 Length:337 Species:Xenopus tropicalis

Alignment Length:354 Identity:128/355 (36%)
Similarity:208/355 (59%) Gaps:25/355 (7%)


  Fly     1 MKIEWAPKGVPMERRRQTFAMAFLILSFMILS---FGSYFFVAAVLFYGSLLWRTIMVIYLVYVY 62
            ||:|:||..:|:.||.||.|:...:.||::|:   .|  .|::.||   :.|| .|:.:|::::|
 Frog     3 MKLEFAPINIPLARRLQTTAVFQWVFSFLLLAQCCIG--IFLSLVL---ARLW-LILALYVLWLY 61

  Fly    63 ANHKRTHSIMDGNGWKINRNNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINM 127
            .:.:...:  .|..|:..||..::::::||||::||||.:|.|..|||:...|||:|..|...|.
 Frog    62 LDWETPQA--GGRRWEWVRNWTVWKYFKDYFPIRLVKTCDLDPQHNYIMGFHPHGVLVAGAFGNF 124

  Fly   128 GLDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDG 192
            ..:.:.:.:|||.:.|.:..|...|..|..|....|.||||.:|:::.::|:|.|.         
 Frog   125 CTNYTGFKELFPGLTPYLHILPFWFRCPFFREYAMSVGLVSATKKSVNHVLSKENG--------- 180

  Fly   193 FTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPN 257
              .|...|::|||:|:||:|||..||.:..||||:|:|.:.|:.:||.|||||.::..||.||..
 Frog   181 --GNISIIVIGGAEESLDAHPGSLILHILKRKGFIKVAFKQGAHLVPVFSFGENELFQQVPNPKG 243

  Fly   258 SRVRRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIH 322
            |.:|..|:.:::|.|.:..:...||||.||||.:|.|..|..|||.||.|.|:..|....::.:|
 Frog   244 SFLRCVQERLQKIMGFAMPLFHARGIFQYSFGLMPYRMPIHTVVGRPIPVKQTLHPTQEEIESLH 308

  Fly   323 KQVIDDLEKMFAKYKDQY-IPNSKQDKLI 350
            :|.:..|..:|.::|::| ||  :.:.||
 Frog   309 QQYLSALRDLFEEHKERYGIP--EHESLI 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 104/290 (36%)
mogat1XP_012825966.1 DAGAT 44..336 CDD:112781 112/312 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43737836
eggNOG 1 0.900 E1_KOG0831
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3271
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T129109
Phylome 1 0.910 0.680 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 1 0.960
109.790

Return to query results.
Submit another query.