DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1941 and Tmem68

DIOPT Version :9

Sequence 1:NP_001286161.1 Gene:CG1941 / 35718 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_082373.1 Gene:Tmem68 / 72098 MGIID:1919348 Length:329 Species:Mus musculus


Alignment Length:257 Identity:61/257 - (23%)
Similarity:99/257 - (38%) Gaps:66/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EWAPKGVPMERRRQTFAMAFL-ILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYAN-HK 66
            ||.  ||........||...| :.:.:||....||              ||.::||..::.: :|
Mouse    27 EWL--GVEQLEDYLNFANHLLWVFTPLILLILPYF--------------TIFLLYLTIIFLHIYK 75

  Fly    67 R--------THSIMDG------NGWKINRNNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHG 117
            |        :|::.||      ..|..:...|   |..:...::     ::|.....|:  |.||
Mouse    76 RKNVLKEAYSHNLWDGARKTVATLWDGHAAVW---HGYEVHGME-----KIPEGAALII--FYHG 130

  Fly   118 ILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFL--TPIVRGLLRSWGLVSVSKEALVYLLTK 180
                .|.|:....::|   :|.|.......:..:|:  .|....||..:..:...:|..|.:|  
Mouse   131 ----AIPIDFYYFMAK---IFIQKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEIL-- 186

  Fly   181 SNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFS 242
                     |.|   :.:||..||.:|||.|.. .|.:...|||||.::||.....|:|.|:
Mouse   187 ---------RSG---HLLAISPGGVREALLSDE-TYNIIWGNRKGFAQVAIDAKVPIIPMFT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 50/210 (24%)
Tmem68NP_082373.1 PlsC 58..303 CDD:223282 52/224 (23%)
LPLAT_MGAT-like 103..309 CDD:153249 40/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.