DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and Mogat3

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_001064308.1 Gene:Mogat3 RGDID:1592588 Length:326 Species:Rattus norvegicus

Alignment Length:337 Identity:125/338 (37%)
Similarity:190/338 (56%) Gaps:35/338 (10%)


  Fly    11 PMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSL--LWRTIMVIYLVYVYANHKRTHSIMD 73
            |:.|..|.||:...:.||:    |........|...||  .| |::|:||:::|.:  |....|.
  Rat     7 PLHRSLQVFAVLQWVFSFL----GLALLCLVTLILASLGRAW-TLVVLYLLWLYQD--RHTPRMG 64

  Fly    74 G--NGWKINRNNW-LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWL 135
            |  :.|.   .|| ::|::|||||::|||||||.|::||:....|||:|..|...|...:.:.:.
  Rat    65 GRRSAWV---RNWAVWRYFRDYFPIKLVKTAELDPSQNYLFGFHPHGVLVVGAFSNFCTEATGFS 126

  Fly   136 QLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAI 200
            .|||.::|.:..|...|..|:.|..:.:.||||..|.:..|||:      |.:      ...||:
  Rat   127 HLFPGLKPHLLMLPCWFQVPLFRDYIMTSGLVSSDKASTSYLLS------HPE------GGRVAV 179

  Fly   201 L-VGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQ 264
            | |||..|||::.||...|.|:|:|||||:::..|:|:||.|||||.|:..|..|||.|.|||.|
  Rat   180 LAVGGPLEALEAKPGTVSLRLRNQKGFVKLSLEHGASLVPVFSFGENDLFQQFPNPPGSWVRRMQ 244

  Fly   265 DFVKRITGISPLIPVGRGIFNYSFGFL-PNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDD 328
            :.::||  :|..:|    :|:...|.| |.|..|..||||||.|.:|.:|....|:::|:..::.
  Rat   245 EALQRI--LSVALP----LFHGRLGLLIPFRVPIHTVVGAPIPVQRSPRPTREQVNRLHELYVER 303

  Fly   329 LEKMFAKYKDQY 340
            |.::|.::|.:|
  Rat   304 LTQLFEEHKMRY 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 113/295 (38%)
Mogat3XP_001064308.1 LPLAT 29..325 CDD:302626 117/312 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43741499
eggNOG 1 0.900 E1_KOG0831
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3250
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T131083
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.693 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.