DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and Dgat2l6

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001102840.1 Gene:Dgat2l6 RGDID:1596935 Length:337 Species:Rattus norvegicus

Alignment Length:356 Identity:129/357 (36%)
Similarity:188/357 (53%) Gaps:44/357 (12%)


  Fly     3 IEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKR 67
            ::|.|              .::||..:.:....||    :||  |..| .:.|::|.:| |....
  Rat    19 LQWIP--------------VYVILGTLSILGIPYF----LLF--STFW-PLSVLFLAWV-AYDWN 61

  Fly    68 THSIMDG--NGWKINRNNW-LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGL 129
            ||| .||  :.|.   .|| |:::::.||||:||||.:|.|..|||:.|.|||||..|..||...
  Rat    62 THS-QDGRRSAWV---RNWTLWKYFQSYFPVKLVKTHDLSPKHNYIILSHPHGILCYGAFINFAT 122

  Fly   130 DISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFT 194
            :.:.:.::||.:.|.:|||:..|..|.||..:.|.|:..||:.||.:.||:..           :
  Rat   123 EATGFSRVFPSITPFLATLEGIFWIPFVRDYVMSMGICPVSELALKHQLTQRG-----------S 176

  Fly   195 SNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSR 259
            .|||.|:.|||.|||...||...:.||.||||||:|::||:.:||::||||.:..:|...|..:.
  Rat   177 GNAVIIVPGGASEALLCCPGVSTVYLKKRKGFVKLALKTGAYLVPSYSFGENEAYNQETFPEGTW 241

  Fly   260 VR----RFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDK 320
            :|    .||...|||.||:.....|||:...|:||||....|..|||.|:.|.:...||...|.|
  Rat   242 LRFFQKNFQKIGKRILGINFCTFHGRGLTRGSWGFLPFNHPITTVVGEPLPVPKILDPDKETVAK 306

  Fly   321 IHKQVIDDLEKMFAKYKDQYIPNSKQDKLII 351
            ..:..|..|.|:|.::|.:|..:..|:..||
  Rat   307 YFELYISALRKLFDQHKTKYDFSKTQELTII 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 116/297 (39%)
Dgat2l6NP_001102840.1 LPLAT 38..336 CDD:302626 123/321 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43719160
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3250
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T131083
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.664 Consistency score
TreeFam 1 0.960
98.860

Return to query results.
Submit another query.