DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and Dgat2l6

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001107556.1 Gene:Dgat2l6 MGIID:3045268 Length:337 Species:Mus musculus

Alignment Length:345 Identity:125/346 (36%)
Similarity:189/346 (55%) Gaps:44/346 (13%)


  Fly     3 IEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKR 67
            ::|.|              .:::|..:.:....|.    :||  :.|| .:.|::||:: |....
Mouse    19 LQWIP--------------VYVLLGTLSILGMPYL----LLF--TTLW-PLSVLFLVWI-AYDWN 61

  Fly    68 THSIMDG--NGWKINRNNW-LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGL 129
            || |.||  :.|.   .|| |:::::.||||:||||.:|.|..|||:.|.|||||..|..||...
Mouse    62 TH-IQDGRRSAWV---RNWTLWKYFQSYFPVKLVKTHDLSPKHNYIILSHPHGILSYGAFINFAT 122

  Fly   130 DISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFT 194
            :.:.:.::||.:.|.:|||:..|..|.||..|.|.|:..|||.:|.:.||:      ||     :
Mouse   123 ESTGFSRVFPSITPFLATLEGIFWIPFVRDYLMSLGICPVSKLSLTHKLTQ------KD-----S 176

  Fly   195 SNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSR 259
            .|||.|:.|||.|:|.|.||..::.||.|:||||:|::||:.:||::||||.:..:|......:.
Mouse   177 GNAVIIVPGGASESLLSRPGVSMIYLKKRQGFVKLALKTGAYLVPSYSFGENETYNQETFAEGTW 241

  Fly   260 VRRFQDFV----KRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDK 320
            :|.||..:    |||.||:.....|||:...|:||||....|..|||.|:.|.:...||...|:|
Mouse   242 LRFFQKNIQKIGKRILGINLCTIHGRGLTRGSWGFLPFNHPITTVVGEPLPVPKIPDPDKETVEK 306

  Fly   321 IHKQVIDDLEKMFAKYKDQY 340
            ..:..|..|.|:|.::|.:|
Mouse   307 YLELYISALRKLFDQHKAEY 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 117/297 (39%)
Dgat2l6NP_001107556.1 LPLAT 38..336 CDD:302626 122/313 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43723110
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I3279
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T130845
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12317
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.950

Return to query results.
Submit another query.