DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and dga1

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001343006.1 Gene:dga1 PomBaseID:SPCC1235.15 Length:345 Species:Schizosaccharomyces pombe

Alignment Length:340 Identity:123/341 (36%)
Similarity:186/341 (55%) Gaps:50/341 (15%)


  Fly    20 AMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTI-----MVIYLVYVYANHKRTHSIMDGNGW-- 77
            |:|..:.|..:....|::         ::||..:     :::||:::         |.| :|:  
pombe    31 ALAVFLHSVSLTLTASWY---------TVLWAFLPFWPFLIVYLIWL---------IYD-DGFVT 76

  Fly    78 -KINRNNWL-----FRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGI---SINMGLDISK 133
             |..:..||     :|.:..|||::|.||.||...||||....||||:..|.   ..:.|.|.||
pombe    77 GKDRQKRWLRNAPPYRWFCHYFPIRLHKTTELDSEKNYIFGYHPHGIISLGAFGGFASEGADFSK 141

  Fly   134 WLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAV 198
               |||.:...|.||:.||..|:.|..|.:..:.||||::.|.:|::.            ..::|
pombe   142 ---LFPGINVSVLTLNSNFYVPVYRDYLMALNINSVSKKSCVSILSRK------------PGDSV 191

  Fly   199 AILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRF 263
            .|::|||||:|.|.||:..|.||.|.||||:|..||||:||.|:|||.||.:||.|.|.:|:.:|
pombe   192 LIVIGGAQESLLSRPGQNNLVLKKRFGFVKLAFLTGSSLVPCFAFGESDIFEQVDNNPRTRIYKF 256

  Fly   264 QDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDD 328
            |:.||:|.|.:.....|||:.|.:||.:|.|:.|..|||.||||.:...|....:.::|::.|..
pombe   257 QEIVKKIAGFTVPFFYGRGLLNKTFGLMPWRKPINIVVGEPIDVPKKSHPTNQEIYEVHEEYIRR 321

  Fly   329 LEKMFAKYKDQYIPN 343
            ||.::.||||.::||
pombe   322 LEGLWNKYKDVFLPN 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 116/306 (38%)
dga1NP_001343006.1 LPLAT 54..333 CDD:327403 115/304 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 204 1.000 Inparanoid score I967
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T631360
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 LDO PTHR12317
Phylome 1 0.910 0.846 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.