DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and dgat2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001025367.1 Gene:dgat2 ZFINID:ZDB-GENE-050913-15 Length:361 Species:Danio rerio

Alignment Length:345 Identity:115/346 (33%)
Similarity:184/346 (53%) Gaps:43/346 (12%)


  Fly    19 FAMAFLILS-----FMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKRTHSIMDGNGWK 78
            |.|.||.:.     .::..|.:.|:|.:||:          |.:|:|.:..        .|.|.:
Zfish    49 FIMTFLTMGIACSLLLMYMFCTDFWVISVLY----------VAWLIYDWNT--------PGQGGR 95

  Fly    79 INRNNW-----LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLF 138
              |:.|     ::::.|||||::|:||..|.|::|||....|||||..|...|.|.:.:.:.::|
Zfish    96 --RSTWVRDWTVWKYMRDYFPIRLIKTHNLLPSRNYIFGYHPHGILCFGAFCNFGTEATGFTKVF 158

  Fly   139 PQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVG 203
            |.::|.:|||..||..|:.|..|...|:..|::.::.|||:.:.           |.|||.|::|
Zfish   159 PGIKPSLATLAGNFRLPMFREYLMCGGICPVNRNSIDYLLSSNG-----------TGNAVVIVIG 212

  Fly   204 GAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVK 268
            ||.|:||..||:..:.||.||||||:|::.|:.:||.:||||.::..|:.....|..|..|..::
Zfish   213 GAAESLDCAPGRNSVMLKKRKGFVKLALKQGADLVPVYSFGENEVYKQLIFEEGSWWRTIQRKLQ 277

  Fly   269 RITGISPLIPVGRGI-FNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKM 332
            :..|.:|.:..|.|: |..|:|.:|..:.|..|||.||.|.:.::|....:|..|...|..|:.:
Zfish   278 KFLGFAPCLFHGCGLFFPESWGLVPYCKPITTVVGEPITVPKIEEPTQDVIDMYHAMYIRSLKSL 342

  Fly   333 FAKYKDQYIPNSKQDKLIIH 352
            |..||.::..| :.|.||||
Zfish   343 FDNYKTRFGLN-ESDTLIIH 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 100/296 (34%)
dgat2NP_001025367.1 DAGAT 65..360 CDD:112781 109/327 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43744139
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3397
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T128579
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.626 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.