DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and mogat2.1

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001011301.1 Gene:mogat2.1 XenbaseID:XB-GENE-6040330 Length:335 Species:Xenopus tropicalis

Alignment Length:367 Identity:120/368 (33%)
Similarity:189/368 (51%) Gaps:59/368 (16%)


  Fly     1 MKIEWAPKGVPMERRRQT-----FAMAFLILS------FMILSFGSYFFVAAVLFYGSLLWRTIM 54
            |.|.:||..:|..||.||     :|::||.::      :::|.|..|:::|              
 Frog     1 MWIHFAPLKIPFSRRLQTGAVLQWAVSFLAMAQCCIALYILLLFSRYWYLA-------------- 51

  Fly    55 VIYLVYVYANHKRTHSIMDGNGWKI-----NRNNW-----LFRHYRDYFPVQLVKTAELPPNKNY 109
            |:|.|::|.:            |..     .|:||     :::::.:|||::|:.||.|.|..||
 Frog    52 VLYGVWLYID------------WDTPSKGGRRSNWVRSWTVWKYFAEYFPIKLLCTAPLDPKYNY 104

  Fly   110 ILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEAL 174
            |:...|||:|..|...|...:.:.:.:|||.:.|.:..|...|..|..|..:.|..|||..:.:.
 Frog   105 IMGFHPHGVLVVGAFGNFCTEGTGFSRLFPGLTPHLLMLPAWFRVPFFREYIMSGSLVSSDRSSA 169

  Fly   175 VYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVP 239
            .:||::.:.           ..|:.|.|||..||||:.||:..|.|.||.||:|||:..|:.:||
 Frog   170 HHLLSQKSG-----------GQALVIAVGGPPEALDAKPGELTLQLLNRTGFIKMALTHGAHLVP 223

  Fly   240 TFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAP 304
            ..||||.|:.:||.||..|.:|..|:.:::|.||:..:..|||:|.||:|.||:||.|..|||:|
 Frog   224 VLSFGENDLYNQVNNPRGSLLRATQEKLQKIFGIALPLFHGRGVFQYSWGLLPHRRPIYTVVGSP 288

  Fly   305 IDVVQSDQPDAAYVDKIHKQVIDDLEKMFAKYKDQY-IPNSK 345
            |.|.::..|....:..:|...|..|..:|..:|..| ||..:
 Frog   289 IHVTKTPCPTREQISSLHSLYIAKLRDLFETHKGNYGIPEDR 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 101/300 (34%)
mogat2.1NP_001011301.1 LPLAT 41..334 CDD:302626 108/328 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43735190
eggNOG 1 0.900 E1_KOG0831
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3271
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T129109
Phylome 1 0.910 0.680 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 1 0.960
109.790

Return to query results.
Submit another query.