DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and mogat3b

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001008626.2 Gene:mogat3b ZFINID:ZDB-GENE-110302-2 Length:336 Species:Danio rerio

Alignment Length:322 Identity:111/323 (34%)
Similarity:167/323 (52%) Gaps:31/323 (10%)


  Fly    24 LILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVY----ANHKRTHSIMDGNGWKINRNNW 84
            |:|||:.|.......:..::|....::.|:...:.:|.:    ...:||..:   .||::    |
Zfish    30 LVLSFLFLGVACLLLMIYLMFTSLWIFPTLYFTWQIYDWHTPERGGRRTKFV---RGWEV----W 87

  Fly    85 LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLD 149
              :|.||||||:|||||||.||||||:...||||:..|.......|.:.:.:.||.:|..:|.|.
Zfish    88 --KHLRDYFPVKLVKTAELNPNKNYIMGCHPHGIMCFGAFSCFSTDRNGFAETFPGIRSTLAILA 150

  Fly   150 QNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPG 214
            ..|..|:.|..:.:.||:.|||.:|.|||:::.           ..|||.|::|||:|:|.|..|
Zfish   151 GLFRLPLFREYILAAGLLPVSKASLDYLLSQTG-----------VGNAVVIIIGGAEESLTSSTG 204

  Fly   215 KYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLI-P 278
            ...:.:|:|||||::|:..|:.:||.:||||.::..||.....|..||.|...|:|.|.:|.| .
Zfish   205 VNTVVIKHRKGFVRLALEHGADLVPVYSFGENELFPQVVLSEGSVGRRLQVLFKQIMGFAPCIFT 269

  Fly   279 VGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKMFAKYKDQY 340
            .||.:      .||.:..:..|||.||:|.....|....||..|...:..|..:|.|:|..|
Zfish   270 GGRWL------LLPYKLPVTTVVGCPINVPLVKIPTQEQVDHYHGLYMASLADLFHKHKTSY 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 104/295 (35%)
mogat3bNP_001008626.2 LPLAT 47..335 CDD:302626 106/306 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43701632
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3397
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T128579
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.626 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.