DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and mogat2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001313629.1 Gene:mogat2 ZFINID:ZDB-GENE-041010-186 Length:368 Species:Danio rerio

Alignment Length:359 Identity:128/360 (36%)
Similarity:191/360 (53%) Gaps:54/360 (15%)


  Fly     1 MKIEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWR--TIMVIYLVYVYA 63
            ||||:||..||:.||.||.::...:.||:.|:     ....|||:..|..|  .|.|:|..:   
Zfish    34 MKIEFAPADVPLVRRLQTASVLQWVFSFLALA-----PCCIVLFFILLFTRFWLISVLYATW--- 90

  Fly    64 NHKRTHSIMDGNGWKINRNNW-----------------LFRHYRDYFPVQLVKTAELPPNKNYIL 111
                         |.|   :|                 ::.:.|||||::|:|||:|...|||::
Zfish    91 -------------WYI---DWDTPSRGGRKVPYLCKLRVWEYMRDYFPIRLIKTADLDTRKNYVM 139

  Fly   112 ASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVY 176
            ...|||||..|...|...:.:.:.:|||.::..:..|...|..|..|..:.|.|||...||:..|
Zfish   140 GFHPHGILVAGAFTNFCTEATGFSKLFPGIKSNLLMLPLWFRAPFFRDYIMSAGLVPSDKESAGY 204

  Fly   177 LLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTF 241
            ||.:...           .|||.|.||||.||||:|||.|.:.|.|:|||:|:||..|:.:||.:
Zfish   205 LLRRKGG-----------GNAVVIAVGGAPEALDAHPGDYTVHLANKKGFIKLAIEHGADLVPIY 258

  Fly   242 SFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPID 306
            ||||.::.|||.||..:.:|..|:.::||.|:|..:...||:|.|:||.:|.|:.|..|||.||.
Zfish   259 SFGENEVFDQVQNPRGTWLRYIQERLQRIMGVSLPLFHARGVFQYTFGLMPYRKPINTVVGRPIP 323

  Fly   307 VVQSDQPDAAYVDKIHKQVIDDLEKMFAKYKDQY 340
            |.::::|.|..:|..|::.:|:|.::|..:|..|
Zfish   324 VEKNEKPTAEELDVYHQRYMDELARLFEDHKGNY 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 108/309 (35%)
mogat2NP_001313629.1 DAGAT 73..368 CDD:112781 110/316 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43731498
eggNOG 1 0.900 E1_KOG0831
Hieranoid 1 1.000
Homologene 1 1.000 H57020
Inparanoid 1 1.050 226 1.000 Inparanoid score I3397
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T128579
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 LDO PTHR12317
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.