DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and Mogat1

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_017452019.1 Gene:Mogat1 RGDID:1311644 Length:317 Species:Rattus norvegicus

Alignment Length:300 Identity:105/300 (35%)
Similarity:152/300 (51%) Gaps:38/300 (13%)


  Fly    21 MAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKRTHSIMDGNGWKINRNNWL 85
            |..|||.       :|:|              :.:.|||:.|.: :||.. ..|..|...:|..:
  Rat     1 MVMLILY-------NYWF--------------LYIPYLVWCYYD-RRTPE-QGGRRWSWVQNWTV 42

  Fly    86 FRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQ 150
            ::::.||||:.||||.:|.|..|||....||||...|...|...:.|.:.:|||.....:.....
  Rat    43 WKYFMDYFPIHLVKTQDLDPAHNYIFGFHPHGIFVFGAFGNFCTNYSDFKKLFPGFTSYLHVAVS 107

  Fly   151 NFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGK 215
            .|..|:.|....|.|.|||||.:|.::::|...           .|...|::|||:|.|:|.||:
  Rat   108 WFWLPLFREYALSNGPVSVSKRSLSHVMSKEGG-----------GNISVIVIGGAKELLESFPGR 161

  Fly   216 YILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPVG 280
            |.|.|..||||||:|:..|:.:||.|||||.::..||.||..|.:|..||.|..:||::..:...
  Rat   162 YSLCLLQRKGFVKIALTHGAHLVPVFSFGENELYSQVDNPKGSWLRTAQDKVYNLTGLALPLFYA 226

  Fly   281 RGIFNYSFGFLPNRRRI--VQVVGAPIDVVQ--SDQPDAA 316
            ||||..|||.:|.|:.|  |..||....:.|  :.|.|::
  Rat   227 RGIFQNSFGLMPYRKLIYTVAAVGTAARLTQKSNHQNDSS 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 99/271 (37%)
Mogat1XP_017452019.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43745972
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127120
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
76.660

Return to query results.
Submit another query.