DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and CG1946

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_610319.2 Gene:CG1946 FlyBaseID:FBgn0033216 Length:349 Species:Drosophila melanogaster

Alignment Length:351 Identity:234/352 (66%)
Similarity:284/352 (81%) Gaps:3/352 (1%)


  Fly     1 MKIEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANH 65
            |.|||||..||:|||.||...:|...:|..|...|...||.:|:||.:..|::::||.|.:|.::
  Fly     1 MTIEWAPLRVPLERRLQTLVTSFFTYTFFTLPISSCLAVAILLYYGEMFVRSLLLIYFVKIYLDY 65

  Fly    66 KRTHSIMDGNGWKINRNNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLD 130
            ||.:.||:||||...|:||   .||:||||:||||||||||:|||:|||||||||||..|||.||
  Fly    66 KRNYGIMEGNGWLFYRSNW---RYRNYFPVELVKTAELPPNRNYIVASFPHGILGTGTCINMSLD 127

  Fly   131 ISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTS 195
            |..||.|:|.||||:||||.:|.||.:|.:||.||:||||||:|.|||:|||||.||||||||||
  Fly   128 IDNWLSLYPHVRPKIATLDHHFKTPFLRDILRWWGMVSVSKESLSYLLSKSNDPMHKDNRDGFTS 192

  Fly   196 NAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRV 260
            ||||:|||||:||:|||||:||||||:||||||||:||||||||:.|||||||.|||||||:|.:
  Fly   193 NAVAVLVGGAKEAMDSHPGQYILTLKDRKGFVKMAVRTGSSIVPSLSFGEVDIFDQVANPPDSSL 257

  Fly   261 RRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQV 325
            ||||:.||:.||||||:|.|||||||::|.||:|||||||||:||||.:.:.||..||||||.||
  Fly   258 RRFQNVVKKFTGISPLLPKGRGIFNYNYGILPHRRRIVQVVGSPIDVERCETPDPEYVDKIHGQV 322

  Fly   326 IDDLEKMFAKYKDQYIPNSKQDKLII 351
            ||.|.:||.:||::|.||||..||||
  Fly   323 IDALARMFDEYKEKYTPNSKHIKLII 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 203/290 (70%)
CG1946NP_610319.2 LPLAT 80..349 CDD:302626 199/273 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C42867715
eggNOG 1 0.900 E1_KOG0831
Homologene 1 1.000 H57020
Inparanoid 1 1.050 93 1.000 Inparanoid score I2180
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 P PTHR12317
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
98.920

Return to query results.
Submit another query.