DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and Dgat2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_610318.1 Gene:Dgat2 FlyBaseID:FBgn0033215 Length:352 Species:Drosophila melanogaster

Alignment Length:352 Identity:257/353 (73%)
Similarity:298/353 (84%) Gaps:0/353 (0%)


  Fly     1 MKIEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANH 65
            |||||||..||:|||.|....||.....:||...|:..||..|.||.||.|::||.||.||:.:|
  Fly     1 MKIEWAPLRVPLERRLQILVTAFFTSMLLILLSVSFLLVAGSLIYGGLLVRSLMVTYLAYVFVHH 65

  Fly    66 KRTHSIMDGNGWKINRNNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLD 130
            |:|.|::|||||.|.|.|.|.|||||||||:||||||||..|||||||||||||||||.|||||:
  Fly    66 KKTQSVVDGNGWMITRTNLLHRHYRDYFPVELVKTAELPATKNYILASFPHGILGTGIGINMGLE 130

  Fly   131 ISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTS 195
            |||||:||||||||:.||||:|..|.:|.:||.|||||||||||:.:|:||||||||||||||||
  Fly   131 ISKWLELFPQVRPKLGTLDQHFHVPFMREVLRCWGLVSVSKEALIRMLSKSNDPKHKDNRDGFTS 195

  Fly   196 NAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRV 260
            |||||||||||||:|||||:||||||||||||:|||||||||||:||||||||.|||||||||.:
  Fly   196 NAVAILVGGAQEAMDSHPGQYILTLKNRKGFVRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSLL 260

  Fly   261 RRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQV 325
            ||||||||::||:|||||||||.|||:|||||.|||||||||||||||:::.||:.||||:|.||
  Fly   261 RRFQDFVKKLTGVSPLIPVGRGFFNYTFGFLPFRRRIVQVVGAPIDVVKNEHPDSEYVDKVHGQV 325

  Fly   326 IDDLEKMFAKYKDQYIPNSKQDKLIIH 352
            |:.|||:|.:|||:|:.|||...|::|
  Fly   326 IESLEKLFDQYKDKYLENSKSATLVVH 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 226/290 (78%)
Dgat2NP_610318.1 LPLAT 74..340 CDD:302626 214/266 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C42867691
eggNOG 1 0.900 E1_KOG0831
Homologene 1 1.000 H57020
Inparanoid 1 1.050 93 1.000 Inparanoid score I2180
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 P PTHR12317
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
98.920

Return to query results.
Submit another query.