DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and DGAT2L6

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_940914.1 Gene:DGAT2L6 HGNCID:23250 Length:337 Species:Homo sapiens

Alignment Length:352 Identity:134/353 (38%)
Similarity:196/353 (56%) Gaps:45/353 (13%)


  Fly     3 IEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKR 67
            ::|.|..:.:.      |:..|::.:.:|.  |.|:..|||   ||.|       |.|.:    .
Human    19 LQWIPVYIFLG------AIPILLIPYFLLF--SKFWPLAVL---SLAW-------LTYDW----N 61

  Fly    68 THSIMDG--NGWKINRNNW-LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGL 129
            ||| ..|  :.|.   .|| |::::|:||||:||||.:|.|..|||:|:.|||||..|:.||...
Human    62 THS-QGGRRSAWV---RNWTLWKYFRNYFPVKLVKTHDLSPKHNYIIANHPHGILSFGVFINFAT 122

  Fly   130 DISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFT 194
            :.:...::||.:.|.|.||::.|..||||..:.|.|:..||..||.||||:..           :
Human   123 EATGIARIFPSITPFVGTLERIFWIPIVREYVMSMGVCPVSSSALKYLLTQKG-----------S 176

  Fly   195 SNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSR 259
            .|||.|:||||.|||...||...|.||.||||||||::||:.:||::||||.::.:|...|..:.
Human   177 GNAVVIVVGGAAEALLCRPGASTLFLKQRKGFVKMALQTGAYLVPSYSFGENEVFNQETFPEGTW 241

  Fly   260 VR----RFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDK 320
            :|    .|||..|:|.|::.....|||....|:||||..|.|..|||.|:.:.:..:|:...|||
Human   242 LRLFQKTFQDTFKKILGLNFCTFHGRGFTRGSWGFLPFNRPITTVVGEPLPIPRIKRPNQKTVDK 306

  Fly   321 IHKQVIDDLEKMFAKYKDQY-IPNSKQ 346
            .|...|..|.|:|.::|.:| :|.:::
Human   307 YHALYISALRKLFDQHKVEYGLPETQE 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 120/297 (40%)
DGAT2L6NP_940914.1 LPLAT 38..336 CDD:302626 130/328 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43720540
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3345
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T130066
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.622 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.