DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and MOGAT3

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_005250366.1 Gene:MOGAT3 HGNCID:23249 Length:344 Species:Homo sapiens

Alignment Length:290 Identity:111/291 (38%)
Similarity:161/291 (55%) Gaps:25/291 (9%)


  Fly    25 ILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKRTHSIMDGNGWKINRNNWLFRHY 89
            :|:|:.:  |.:|.:...:...:.|| ...|.|||::|.:....:.....:.|..||..|  |..
Human    30 VLTFLFM--GPFFSLLVFVLLFTSLW-PFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIW--RQL 89

  Fly    90 RDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFLT 154
            |||:||:|||||||||::||:|.:.||||:.||...|...:.:.:.||||.:||.:|.|...|..
Human    90 RDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYL 154

  Fly   155 PIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILT 219
            |:.|..:.|:||..||:::|.::|::..           ...||.|:||||.|||.|.||::.||
Human   155 PVYRDYIMSFGLCPVSRQSLDFILSQPQ-----------LGQAVVIMVGGAHEALYSVPGEHCLT 208

  Fly   220 LKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGIF 284
            |:.|||||::|:|.|:|:||.:||||.||....|....|.....|...|::.|.||.|..|||:|
Human   209 LQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLF 273

  Fly   285 N-YSFGFLPNRRRIVQVVGAPIDVVQSDQP 313
            : .|:|.||        ...||..|....|
Human   274 SATSWGLLP--------FAVPITTVGECPP 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 106/266 (40%)
MOGAT3XP_005250366.1 LPLAT 45..290 CDD:327403 105/267 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43699203
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3345
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T130066
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.622 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.