DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1941 and CG34348

DIOPT Version :9

Sequence 1:NP_001286161.1 Gene:CG1941 / 35718 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster


Alignment Length:346 Identity:87/346 - (25%)
Similarity:135/346 - (39%) Gaps:102/346 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKRTHSIM-----DGNGWKINRN- 82
            ||::|::    ...|||  |.|.|.|        ::::|..|::.  ||     |.|.|::.|. 
  Fly    34 LIVTFLL----PLVFVA--LIYISFL--------VLFIYKLHRQV--IMRAVQGDRNFWRVGRKI 82

  Fly    83 ---NWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPK 144
               .| ..|.|.|...::: ..|..|.:...|..:.||    .|.|:|....|:.|.   |....
  Fly    83 VAAIW-DAHARIYHGYEVI-GLENVPQEGPALIVYYHG----AIPIDMYYLNSRMLL---QRERL 138

  Fly   145 VATLDQNFLTPIVRGLLRSWGLVS----VSK---EALVYLLTKSNDPKHKDNRDGFTSNAVAILV 202
            :.|:...||..     |..||.:|    ||.   ::.|.:|           |||   |.:||..
  Fly   139 IYTIGDRFLFK-----LPGWGTISEAFHVSPGTVQSCVSIL-----------RDG---NLLAISP 184

  Fly   203 GGAQEA-LDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFS------FGEVDILDQVANPPNSRV 260
            ||..|| ...|  .|.|..:||.||.|:||...:.|:|.|:      |.:|.|            
  Fly   185 GGVYEAQFGDH--YYELLWRNRVGFAKVAIEAKAPIIPCFTQNLREGFRQVGI------------ 235

  Fly   261 RRFQDFVKRITG--ISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHK 323
              |:.|..|:..  ..|:.|:        :|..|.:.|  ..:|.||...::..|....:     
  Fly   236 --FRTFFMRLYNKVRIPVYPI--------YGGFPVKFR--TYLGKPIPYDENLTPQDLQI----- 283

  Fly   324 QVIDDLEKMFAKYKDQYIPNS 344
            :|...:|.:..::  |.:|.|
  Fly   284 KVATAIEDLINQH--QRLPGS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 74/314 (24%)
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 74/287 (26%)
LPLAT_MGAT-like 90..298 CDD:153249 65/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.