DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and Awat2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001178653.1 Gene:Awat2 RGDID:1565111 Length:333 Species:Rattus norvegicus

Alignment Length:335 Identity:103/336 (31%)
Similarity:176/336 (52%) Gaps:24/336 (7%)


  Fly    19 FAMAFLILSFMILSFGSYFFVAAVLFYGSLLW--RTIMVIYLVYVYANHKRTHSIMDGNGWKINR 81
            :|::.|::...::....|.    |:|  :..|  ..:|:::|.:.:...:|     .|..:...|
  Rat    21 WALSALVIVITVIMVNLYL----VVF--TSFWPVTVLMLLWLAFDWKTPER-----GGRRFNCVR 74

  Fly    82 NNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVA 146
            ...|::||.:|||:::|||.::|.|.|||||..|||:|......:...|.:.:.::||.:.|.:.
  Rat    75 RWCLWKHYSNYFPLKIVKTKDIPTNHNYILACHPHGLLSHSWFGHFSTDTTGFSKIFPGITPYML 139

  Fly   147 TLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDS 211
            ||...|..|.:|..:.|.|..|||:.::.:|||:..           |.|.:.::|||..|...|
  Rat   140 TLGAFFWVPFLREYIMSTGACSVSQSSIDFLLTQKG-----------TGNMLVVVVGGLAECKYS 193

  Fly   212 HPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPL 276
            .||...|.||.|:|||:.|:|.|.|::|.::|||.|:.||....|.|.:..||.:.:::..:.|.
  Rat   194 MPGSTTLFLKKRQGFVRTALRYGVSLIPAYAFGEADLYDQHIFTPGSFISHFQKWFQKMVHVYPC 258

  Fly   277 IPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKMFAKYKDQYI 341
            ...|||....|:|.||..:.:..:||.|:.:.:.:.|....|.|.|...||.|.|:|.::|.::.
  Rat   259 AFYGRGFTKNSWGLLPYSQPVTTIVGEPLPLPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFG 323

  Fly   342 PNSKQDKLII 351
            .:..|:.:||
  Rat   324 ISETQELVII 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 95/292 (33%)
Awat2NP_001178653.1 LPLAT 38..332 CDD:302626 99/316 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43719229
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3250
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T131083
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.655 Consistency score
TreeFam 1 0.960
98.860

Return to query results.
Submit another query.