DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and Dgat2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001012345.1 Gene:Dgat2 RGDID:620329 Length:388 Species:Rattus norvegicus

Alignment Length:354 Identity:119/355 (34%)
Similarity:191/355 (54%) Gaps:37/355 (10%)


  Fly     3 IEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYG--SLLWRTIMVIYLVYVYANH 65
            :.|..:. .:|:..|..::...:|||::|...    .:.:|.|.  :..| .|..:|..::    
  Rat    56 VTWLNRS-KVEKHLQVISVLQWVLSFLVLGVA----CSVILMYTFCTDCW-LIAALYFTWL---- 110

  Fly    66 KRTHSIMDGNGWKI--NRNNW-----LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGI 123
                 ..|.|..|.  .|:.|     ::|::|||||:|||||..|...:|||....||||:|.|.
  Rat   111 -----AFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGA 170

  Fly   124 SINMGLDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKD 188
            ..|...:.::..:.||.:||.:|||..||..|::|..|.|.|:..|:::.:.|||:|:.      
  Rat   171 FCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVNRDTIDYLLSKNG------ 229

  Fly   189 NRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVA 253
                 :.||:.|:||||.|:|.|.|||..:||:|||||||:|:|.|:.:|||:||||.::..||.
  Rat   230 -----SGNAIVIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPTYSFGENEVYKQVI 289

  Fly   254 NPPNSRVRRFQDFVKRITGISPLIPVGRGIFNY-SFGFLPNRRRIVQVVGAPIDVVQSDQPDAAY 317
            ....|..|..|...::..|.:|.|..|||:|:. ::|.:|..:.|..|||.||.|.:.:.|....
  Rat   290 FEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITVPKLEHPTQKD 354

  Fly   318 VDKIHKQVIDDLEKMFAKYKDQY-IPNSK 345
            :|..|...::.|.|:|..:|.:: :|.::
  Rat   355 IDLYHTMYMEALVKLFDNHKTKFGLPETE 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 109/298 (37%)
Dgat2NP_001012345.1 DAGAT 92..388 CDD:112781 111/314 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43751302
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3250
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T131083
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.664 Consistency score
TreeFam 1 0.960
1110.770

Return to query results.
Submit another query.