DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and Awat1

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001074605.1 Gene:Awat1 MGIID:3588200 Length:328 Species:Mus musculus

Alignment Length:323 Identity:116/324 (36%)
Similarity:172/324 (53%) Gaps:19/324 (6%)


  Fly    31 LSFGSYFFVAAVLFYGSL---LWRTIMVIYLVYVYANHKRTHSIMDGNGWKINRNNWLFRHYRDY 92
            ||:.:.|::...|....|   || .:..:|.|::..:.|........:.|..|.|.|  .|.|||
Mouse    20 LSYVAMFWIVQPLLICLLFTPLW-PLPTVYFVWLLLDWKTPDKGGRRSDWVRNWNVW--NHIRDY 81

  Fly    93 FPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFLTPIV 157
            ||:.::||.:|.|::|||:...|||:|..|...|...:.:.:.:.||.:.|.:|||...|..||:
Mouse    82 FPITILKTKDLSPSENYIMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPII 146

  Fly   158 RGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKN 222
            |..:.:.||.|||:.::.|||:..            |.|.|.|:|||..|||.|.|....|.||.
Mouse   147 RDYIMAKGLCSVSQASIDYLLSHG------------TGNLVGIVVGGVGEALQSVPNTTTLLLKK 199

  Fly   223 RKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGIFNYS 287
            |||||:.|::.|:.:||||:|||.::.|||....:||:.:||...:||.|....:..|:|.....
Mouse   200 RKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHEDSRMFKFQSLFRRIFGFYCCVFYGQGFHQDC 264

  Fly   288 FGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKMFAKYKDQYIPNSKQDKLI 350
            .|.||..:.|:.|||..:.:.|...|....|||.|...:|.|.|:|.::|.||..::.| |||
Mouse   265 KGLLPYHKPIITVVGEALPLPQVKNPSPEIVDKYHALYMDALYKLFEQHKVQYGCSNTQ-KLI 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 105/290 (36%)
Awat1NP_001074605.1 LPLAT 36..327 CDD:302626 112/308 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43716243
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I3279
Isobase 1 0.950 0 Normalized mean entropy S1864
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T130845
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12317
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.900

Return to query results.
Submit another query.