DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and Awat2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_808414.2 Gene:Awat2 MGIID:3045345 Length:333 Species:Mus musculus

Alignment Length:328 Identity:101/329 (31%)
Similarity:171/329 (52%) Gaps:27/329 (8%)


  Fly    24 LILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKRTHSIMDGNGWKINRNNWLFRH 88
            :|::..::.|.||:.|.           .:|:.:|.:.:...:|     .|..:...|...|::|
Mouse    33 IIVNLYLVVFTSYWPVT-----------VLMLTWLAFDWKTPER-----GGRRFTCVRKWRLWKH 81

  Fly    89 YRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFL 153
            |.||||:::|||.::.|::||||...|||::......:...|.:.:.:.||.:.|.:.||...|.
Mouse    82 YSDYFPLKMVKTKDISPDRNYILVCHPHGLMAHSCFGHFATDTTGFSKTFPGITPYMLTLGAFFW 146

  Fly   154 TPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYIL 218
            .|.:|..:.|.|..|||:.::.:|||:..           |.|.:.::|||..|...|.||...|
Mouse   147 VPFLRDYVMSTGSCSVSRSSMDFLLTQKG-----------TGNMLVVVVGGLAECRYSTPGSTTL 200

  Fly   219 TLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGI 283
            .||.|:|||:.|::.|.|::|.::|||.|:.||....|...|.|||.:.:::..|.|....|||:
Mouse   201 FLKKRQGFVRTALKHGVSLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQKMVHIYPCAFYGRGL 265

  Fly   284 FNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKMFAKYKDQYIPNSKQDK 348
            ...|:|.||..:.:..|||.|:.:.:.:.|....|.|.|...||.|.|:|.::|.::..:..|:.
Mouse   266 TKNSWGLLPYSQPVTTVVGEPLPLPKIENPSEEIVAKYHTLYIDALRKLFDQHKTKFGISETQEL 330

  Fly   349 LII 351
            :|:
Mouse   331 VIV 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 94/290 (32%)
Awat2NP_808414.2 LPLAT 38..332 CDD:302626 99/321 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43707144
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I3279
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T130845
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.617 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.860

Return to query results.
Submit another query.