DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and Mogat2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_011240039.1 Gene:Mogat2 MGIID:2663253 Length:348 Species:Mus musculus

Alignment Length:316 Identity:120/317 (38%)
Similarity:183/317 (58%) Gaps:25/317 (8%)


  Fly    38 FVA---AVLFYGSLLWR--TIMVIYLVYVYANHKRTHSIMDGNGWKINRNNWLFRHYRDYFPVQL 97
            |||   .|:|.|.|..|  ...|:|..:.|.:..:..  ..|...:..|...::::.:|||||.|
Mouse    43 FVAQLCIVIFVGLLFTRFWLFSVLYATWWYLDWDKPR--QGGRPIQFFRRLAIWKYMKDYFPVSL 105

  Fly    98 VKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLR 162
            ||||||.|::|||....|||:|..|..:|:..:.:.:..|||.:|..:..|...|..|..|..:.
Mouse   106 VKTAELDPSRNYIAGFHPHGVLAAGAFLNLCTESTGFTSLFPGIRSYLMMLTVWFRAPFFRDYIM 170

  Fly   163 SWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFV 227
            |.||||..|.:..::|::...           .|.:||:|||||||||:.||.|.|.|||||||:
Mouse   171 SGGLVSSEKVSADHILSRKGG-----------GNLLAIIVGGAQEALDARPGAYRLLLKNRKGFI 224

  Fly   228 KMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGIFNYSFGFLP 292
            ::|:..|:::||.|||||.::.:||.|.|.:.:|..|:.:::|.|||..:..|||:|.||||.:|
Mouse   225 RLALMHGAALVPIFSFGENNLFNQVENTPGTWLRWIQNRLQKIMGISLPLFHGRGVFQYSFGLMP 289

  Fly   293 NRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKMFAKYK-------DQYI 341
            .|:.|..:||.||:|..:.||....||::|::.|.:|.|:|.::|       ||::
Mouse   290 FRQPITTIVGKPIEVQMTPQPSREEVDRLHQRYIKELCKLFEEHKLKFNVPEDQHL 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 113/299 (38%)
Mogat2XP_011240039.1 LPLAT 55..347 CDD:302626 114/305 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43728948
eggNOG 1 0.900 E1_KOG0831
Hieranoid 1 1.000
Homologene 1 1.000 H57020
Inparanoid 1 1.050 242 1.000 Inparanoid score I3279
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T130845
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 LDO PTHR12317
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.