DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and dgtr-1

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_504649.1 Gene:dgtr-1 WormBaseID:WBGene00020910 Length:359 Species:Caenorhabditis elegans

Alignment Length:338 Identity:121/339 (36%)
Similarity:182/339 (54%) Gaps:26/339 (8%)


  Fly     6 APKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKRTHS 70
            ||..||.:||.:|.|:...|..::||.....:....|||  :..|..::.:|.|:.|.:      
 Worm    28 APLLVPWKRRLETLAVMGFIFMWVILPIMDLWVPFHVLF--NTRWWFLVPLYAVWFYYD------ 84

  Fly    71 IMDGNGWKINRNNWLFRH-----YRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLD 130
             .|.......|.||..||     :..|||::|:|||:||.::|||:.|.|||:...|....|..:
 Worm    85 -FDTPKKASRRWNWARRHVAWKYFASYFPLRLIKTADLPADRNYIIGSHPHGMFSVGGFTAMSTN 148

  Fly   131 ISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTS 195
            .:.:...||.::..:.||:..|..|..|......|.:.||||:|.|.|||..           ..
 Worm   149 ATGFEDKFPGIKSHIMTLNGQFYFPFRREFGIMLGGIEVSKESLEYTLTKCG-----------KG 202

  Fly   196 NAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRV 260
            .|.||::|||.|||::||.|..|||.||:||.|.|::.|:.:||.::|||.|:.:|..||..||:
 Worm   203 RACAIVIGGASEALEAHPNKNTLTLINRRGFCKYALKFGADLVPMYNFGENDLYEQYENPKGSRL 267

  Fly   261 RRFQDFVKRITGISPLIPVGRGIFN-YSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQ 324
            |..|:.:|.:.|:.|.:..||.:|| |..|.||.|:.:..|:|.||.|.|:|:|....:|::|.:
 Worm   268 REVQEKIKDMFGLCPPLLRGRSLFNQYLIGLLPFRKPVTTVMGRPIRVTQTDEPTVEQIDELHAK 332

  Fly   325 VIDDLEKMFAKYK 337
            ..|.|..:|.:||
 Worm   333 YCDALYNLFEEYK 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 107/295 (36%)
dgtr-1NP_504649.1 DAGAT 63..359 CDD:112781 110/304 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C42867816
eggNOG 1 0.900 E1_KOG0831
Hieranoid 1 1.000
Homologene 1 1.000 H57020
Inparanoid 1 1.050 236 1.000 Inparanoid score I2111
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T97970
orthoMCL 1 0.900 OOG5_127120
Panther 1 1.100 LDO PTHR12317
Phylome 1 0.910 0.982 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.