DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and dgat-2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_507469.1 Gene:dgat-2 WormBaseID:WBGene00010296 Length:345 Species:Caenorhabditis elegans

Alignment Length:358 Identity:135/359 (38%)
Similarity:195/359 (54%) Gaps:37/359 (10%)


  Fly     3 IEWAPKGVPMERRRQTFAMAF---LILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLV-YVYA 63
            |:|.....|.:|:|..||:..   ||..|..|...:.|    |||:.. .| .|:.:|.| |:|.
 Worm    13 IKWVNIFSPWDRQRAYFALVVWFGLIYPFCCLCQVAPF----VLFFTG-QW-IILGLYAVWYLYD 71

  Fly    64 NHKRTHSIMDGNGWKINRNNW-----LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGI 123
            ......     .|:   |:||     |.:.:.:||||:|.|||||.||:||:....||||||.|.
 Worm    72 RESPRR-----GGY---RDNWFRNLSLHKWFAEYFPVKLHKTAELDPNQNYLFGYHPHGILGVGA 128

  Fly   124 SINMGLDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKD 188
            ....|.|.....|:|..:|..:.||..||.....|.:|.|.|::..|||::.::|....      
 Worm   129 WSCFGFDACNVKQVFKGIRFNICTLPGNFTAMFRREILLSIGMIESSKESIEHVLNSEE------ 187

  Fly   189 NRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVA 253
                 ...||.|:||||.|||::||||:.|||.||||||:.|::||:.:||.::|||.||..|:.
 Worm   188 -----KGRAVVIVVGGAAEALEAHPGKHTLTLANRKGFVREAVKTGAHLVPVYAFGENDIYKQID 247

  Fly   254 NPPNSRVRRFQDFVKRITGIS-PLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAY 317
            ||..|::|:.|::.|:..||| ||| .|||.|..:.|.||..|.:..||||||.|.:...|....
 Worm   248 NPEGSKLRKIQEWGKKKMGISLPLI-YGRGYFQMALGLLPMSRAVNVVVGAPIQVEKELDPSKEV 311

  Fly   318 VDKIHKQVIDDLEKMFAKYKDQYIPNSKQDKLI 350
            :|:||...::.|.::|.::|.:: ..||..:|:
 Worm   312 IDEIHGVYMEKLAELFEEHKAKF-GVSKDTRLV 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 117/297 (39%)
dgat-2NP_507469.1 DAGAT 50..345 CDD:112781 124/322 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C42867850
eggNOG 1 0.900 E1_KOG0831
Hieranoid 1 1.000
Homologene 1 1.000 H57020
Inparanoid 1 1.050 236 1.000 Inparanoid score I2111
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T97970
orthoMCL 1 0.900 OOG5_127120
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.981 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.670

Return to query results.
Submit another query.